Conserved Protein Domain Family
FRQ

?
pfam09421: FRQ 
Frequency clock protein
The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa. This protein has been shown to interact with itself via a coiled-coil.
Statistics
?
PSSM-Id: 401394
View PSSM: pfam09421
Aligned: 13 rows
Threshold Bit Score: 1261.24
Threshold Setting Gi: 67476450
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EGR49196       18 HPLPRRTSPENSITLRHHQLARDASLRASRGSAPPKQTKq--------DTSSP-RRASSGESHETGQSDANNWFDQSNQN 88   Trichoderma r...
CCE27108        7 SPLPRRSSPEKSVTLKHFRVTRDVSLKASSGSTPAKDSN---------TSSSP-RRDSSGDSNETGQSDPKNWFDQSNEN 76   Claviceps pur...
EFY91968       22 HPLPRRASPGNSVTLKHHQLARDASLRASPGSSPAAANPs-------nVTSSP-RRNSSGESHETGQSDPKKWFDLSNQN 93   Metarhizium a...
EHK43939       19 HPLPRRTSGEHSITLRHHQLARDASLKASRGSAPPNQSNg-------eHLSSP-RRNSSGESNETGQSDANKWFDQSNQN 90   Trichoderma a...
EHK24183       18 HPLPRRTSPETSITLRYHQLARDASLKASRGSVPPNQGDq--------DSSSP-HRASSGESHETGQSDAKKWFNQSNQN 88   Trichoderma v...
XP_003052072   21 HPLPRRTSPANSVTLRHHRLARDASLKASPGSAPPVVTT---------TTTSP-RRNSSGDSHETGQSDPTTWFDHSNQN 90   [Nectria] hae...
XP_011324674   22 HPLPRRTSPANSVTLRHHRLARDASLKASQGSGPAVKTT---------TTSSP-RRNSSGDSNETGQSDPNTWFDQSNQN 91   Fusarium gram...
P19970         21 HPLPRRASPDKSITLENHRLARDTSSRVTSSSALGVTESqp------qLKSSPtRRNSSGES------EPTNWFNQSNRN 88   Neurospora cr...
EGY17172       21 QPMPRRTSPDKSVTLQHHRLVRDASLRNAASRRSAQSSQvptisihkdVDASP-TRGSSSESQDTTQSDAMRWFDRSNEN 99   Verticillium ...
EQB45155       19 HPLPRRSSPENSVTLRNHLLASQASDRAASSRIAAAASSg--------SSSSP-RRQSSGESHNTGPSDPKKWFDRNNEN 89   Colletotrichu...
ENH76664       19 HPLPRRSSPEHSVTLLHHRLARQASERAASTLAAAAASSg--------SFSSP-RRHSSGESHNTGPSDPKKWFDQNNEN 89   Colletotrichu...
XP_008091539   20 HPLPRRSSPENSITLRHHRLAHEASAKALSKRAAAAAETs--------SGSSP-HRHSSGESHNTGPSDPKKWFEQSNEN 90   Colletotrichu...
OBR16180       20 HPLPRRSSPEQSITLRNHRLAQEASTRAASMRAAPEISS---------GSSSP-RRQSSGESHNTGPSDPKKWFDQNNEN 89   Colletotrichu...
EGR49196       89 PTATFDNNT--MD------VEPPFFQKESDSSNE-------E--KPGQSPP--PVPR-----NLSNARSSSADDYRSVID 144  Trichoderma r...
CCE27108       77 PTADFDNAA--MD------VDPPFYQKQSDSSNE-------D--KPYTYRNa-EPRP-----RLATGQSSSADDYRSVID 133  Claviceps pur...
EFY91968       94 PTATFDNNA--MD------VDPPFFQKESDLSNE-------D--KPYQFQR--PPPP-----RLATGQSSSADDYRSVID 149  Metarhizium a...
EHK43939       91 PTATFHSNS--MDvaharvVDPPFFQKESDSSNE-------D--KPYQYLT--AVPP-----TPNDARSSSADDYRSVID 152  Trichoderma a...
EHK24183       89 PTATFDSNA--MD------VDPPFFQKESDSSNE-------D--KPYQP----AAPR-----IQSNPRSSSADDYRSVID 142  Trichoderma v...
XP_003052072   91 PTATFDSNI--MD------VDPPFFQKESDSSNE-------E--KPFPYTHq-LAPP-----KLTTAQSSSADDYRSVID 147  [Nectria] hae...
XP_011324674   92 PTATFDSNV--ME------VDPPFFQKESDSSNE-------D--KPYYNQ---LAPP-----KLTAAHSSSADDYRSVID 146  Fusarium gram...
P19970         89 PAAAFHDEShiME------VDPPFYQKETDSSNEesryppgR--NPVHPPGgvQLPGf----RPVAAHSSAADDYRSVID 156  Neurospora cr...
EGY17172      100 PTAAY-TQG--MD------VDPPFYQKESDSSNE-------Dg-NKATYPFh-LKPGashslRPPAARSSSTGDYRSVID 161  Verticillium ...
EQB45155       90 PTAGY-SNA--MD------VDPPFFQKESDSSNE-------DmvKGDSYPPhlLKPPvdaklKPTATHSSSADDYRSVID 153  Colletotrichu...
ENH76664       90 PTALY-SQA--MD------VDPPFFQKESDSSNE-------DmpKPTSYPAhlLKPPvsgllKPSATHSSSADDYRSVID 153  Colletotrichu...
XP_008091539   91 PAVLY-SNA--ID------VDPPFFQKESDSSHE-------DntQPTSYPTh-LKRSiggtlKPSATHSSSADDYRSVID 153  Colletotrichu...
OBR16180       90 PTASY-SHG--MD------VDTPFFQKMSESSNE-------DnpQQTSYPTh-LVPPmpgnfKPSATHSSSADDYRSVID 152  Colletotrichu...
EGR49196      145 DLTVEIQKLKEELKRYKQRGPDMLRKDKLFEIKMHGLPKRKKRELEATLRDFAAGLsGDSPETTSSQRnKSSSRHATRER 224  Trichoderma r...
CCE27108      134 DLTVEIQKLKEELKRYKQRGPDMMKKDKLFEIKYHGLPKSKRRELETTLRDFAGSI-EGSLNETPSQR-KKFLRQSNRDH 211  Claviceps pur...
EFY91968      150 DLTVEIQKLKEELKRYKQKGPETLRKDKLFEIKYHGLPRRRRRELESTLRDFAASI-EDSPDAPSSQR-KKSLRHATRDH 227  Metarhizium a...
EHK43939      153 DLTVEIQKLKEELKRYKQHGPDMLRKDKLFEIKIHGLPKRKKRELEATLRDFTASL-GDSPGNSSSKRdKKSSRHATRDG 231  Trichoderma a...
EHK24183      143 DLTVEIQKLKDELKRYRQRGPDMLRKDKLFEIKIHGLPKRKKRELEATLREFTASL-GDSPDTSSSQRnKKSSRHATRDR 221  Trichoderma v...
XP_003052072  148 DLTVEIQKLREELKRYKQPGPDLLRKEKLFEIKVHGLPKKKKRELEATLRDFAASL-EGSPDTSSSQKkKKSSRHQTRDN 226  [Nectria] hae...
XP_011324674  147 DLTVEIQKLREELKRYKNTGPDMLRKEKLFEIKCHGLPKKKKRELEATLRDFAASL-DGSPNTSSSQNkKK-SRHASRDN 224  Fusarium gram...
P19970        157 DLTVENKRLKEELKRYKQFGSDVMRKEKLFEIKVHGLPRRKKRELEATLRDFAASLgDSS---ESTSQrRKTGRHGTA-- 231  Neurospora cr...
EGY17172      162 DLTVEIQKLKDELKKYKQSGPDLLKRDKLFEIKVHGLPKRKKRELEATLRDFASGL-SESASAETSSArKKSSRNHDK-- 238  Verticillium ...
EQB45155      154 DLTIEIKKLKDELKKHKHKGPELMKRDKLFEIKVHGLPKRKKRELEATLREFAAGLeSSTPSAEASSArKK-SRHNAR-- 230  Colletotrichu...
ENH76664      154 DLTVEIKRLKNELKRYKHKGPDMLKRDKLFEIKMHGLPKRKKRELENTLRDFASGLeSNTPSADASSArKK-SRHAAR-- 230  Colletotrichu...
XP_008091539  154 DLTVEIKRLKDELKRYKQRGPEMMKQDRLFEIKVHGLPKRKKRELEITLRDFASGLeSSTPSAEASSGrNK-GSHKAR-- 230  Colletotrichu...
OBR16180      153 DLTIEIKRLKDELKRYKQKGPEMMKRDKLFEIKVHGLPKRKKRELESTLRDFASGLeSKSPSAETSSArQK-SRHMAR-- 229  Colletotrichu...
EGR49196      225 MYSGSNSLsqSKHASSSSGSNTRPVDSAYASMSTG-----AGSSGTSLNRPQGGSRFRt-NDQKVENYLREIPEGLYPRL 298  Trichoderma r...
CCE27108      212 MYSDSAFA--SKHASSSSGSNNRPVDSAYASMSSG-----ANSSGTYPGQTTTKSRAK--NDLKVESYLRDIPEGLYPRN 282  Claviceps pur...
EFY91968      228 MYSASGSA--SKHASSSSGSNARPVDSAYASMSSA-----ANSSGASLGRPSVGSRVR--SDQKVENYLRDIPEGLYPRH 298  Metarhizium a...
EHK43939      232 MTSGSGSMslSKHASSSSGSHTRPVDSAYASMSTG-----AGSSGTSLNRPQGGARFKs-NEAKVENYLRDIPEGLYPRS 305  Trichoderma a...
EHK24183      222 MYAGSGSKsqSKHASSSSGSHTRPVDSAYASMSIG-----AGSSGTSLNRPQGGSRFKt-NEQKVENYLREIPEGLYPRF 295  Trichoderma v...
XP_003052072  227 MYSASGSF--SKHASSSSGSNFRPADSAYASMSTG-----AKSSGTSMNRPIMGSQARs-SEQKVESYLRDIPEGLYPRH 298  [Nectria] hae...
XP_011324674  225 MYSGSG----SKHASSSSGSNFRPADSAYASMSTG-----AKSSGTSLSRPSMGSQAKs-SE-AVENYLRDIPEGLYPRH 293  Fusarium gram...
P19970        232 VHSSGVSL--SKHDSSSS-SRSRPVDSAYNSMSTGrsshaPHSSGPSLGRPSL-TRAKsvGTQKVENYLRDTPDGLLPHH 307  Neurospora cr...
EGY17172      239 MYSVSGSM--SKHASSSSGSNWKHADSAYASASTG-----PNTSGTSITRPSMSSRARs-SEQKVESYLKDIPEGLYPRH 310  Verticillium ...
EQB45155      231 LESGSGSM--SKHASSSSGSHSRPVDSAYASMSTG-----ANSSGTSLARPSISSRARs-SEQKVQNYLKDIPEGLYPRH 302  Colletotrichu...
ENH76664      231 LDSGSGSM--SKHASSSSGSHSRPVDSAYASMSTG-----ANSSGTSLARPSISSRARs-SEQKVESYLKDIPEGLYPRH 302  Colletotrichu...
XP_008091539  231 LESGSGSA--SKHASSTSGSHSRPVDSAYASMSTG-----ANSSGTSLARPSASSRAKs-SEQKVENYLKDIPEGLYPRH 302  Colletotrichu...
OBR16180      230 LESGSGSA--SKHASSSSGSQSRPVDSAYASMSIG-----ANSSGTSLARPSISSRAKs-SDQKVENYLKDIPEGLYPRH 301  Colletotrichu...
EGR49196      299 VPMTEKEKKKLVVRRLEQIFTGKISGKHSRK--NQTGEPPPGSAP-----PPAQATPGHASPRRSSLVQIPtpklsthgs 371  Trichoderma r...
CCE27108      283 ITLTDREKKKLVVRRLEQLFTGKFGGRHGRHlmQRLHAPGMLASE-----IDAELQPKLLREQQSTVTEGP--------- 348  Claviceps pur...
EFY91968      299 MILTDRDRKKLVVRRLEQLFTGKIGGRHARR--ARHRQTDGVEADrasadIDSRAQPPLAKQQ-------Ptpatnaaag 369  Metarhizium a...
EHK43939      306 LSMTEKERKKLVVRRLEQIFTGKFAGRHARR--NQASQTAPASAA-----QVPLGPPGAHSPLRPSSVQQPklkps---- 374  Trichoderma a...
EHK24183      296 VSLTEKEKKKLVVRRLEQIFTGKIGGKHAHR--SQPTQPPVVSIV-----PPAKATLGNPSPQRSSLVQQPkpspnanpg 368  Trichoderma v...
XP_003052072  299 MIMTDKDRKKLVVRRLEQLFTGKISGRHVVK--KQSSAPSGNSAAla--pVVADTQPNVSSA--SIVHEPPalq------ 366  [Nectria] hae...
XP_011324674  294 MIMTEKERKKLVVRRLEQLFTGKIGGRHVVR--KQPVQPSGSSAAla--sVVADTQPNVTNTSNSSIHEPPtlqt----- 364  Fusarium gram...
P19970        308 IVMTDKEKKKLVVRRLEQLFTGKISGRNMQR--NQSMPS-----------MDAPLAPE------GTNMAPPrp------- 361  Neurospora cr...
EGY17172      311 MVMTDKEKKKLVVRRLEHLFTGKITGQAFRE--KGA--------------VLAAKSSDVTTGQGSMVHQPPsla------ 368  Verticillium ...
EQB45155      303 MVMTDKDKKKLIVRRLEQIFTGRITGRNLTR--HQPKSAADMA-------SMAPIMVEPATGHTTTKHGPLnasm----- 368  Colletotrichu...
ENH76664      303 TVMTDKDKKKLIVRRLEQIFTGRITGKSLAR--DLPKASANIA-------NLAPIMVEPATGHTTTNHGPPnill----- 368  Colletotrichu...
XP_008091539  303 MVMTDKDKKKLIVRRLEQIFTGRISGRSVSR--HQPKSSGNIA-------SYAPIMVEPATGNTTTTHGPSnvpt----- 368  Colletotrichu...
OBR16180      302 MVLTEKDKKKLIVRRLEQIFTGRIGGRNLTQ--NQPKSSANIA-------SYAPIMVEPATGHTTTNHGPSnvpm----- 367  Colletotrichu...
EGR49196      372 snmkpplEPVREARFSAAEQHSGQGEKKSR-SQDMGSASNSNEDQTEPGGTGSGSgtahgngnsGSGTNPSPPMPPPPEQ 450  Trichoderma r...
CCE27108      349 -------EACREAKILPQDQQYGPYEKKNQ-SRDTASTSNSNGDHVESGANGIGS---------RSGANTSPTQPEALDQ 411  Claviceps pur...
EFY91968      370 aaaagnsEPSREAKILPPEQQSGHSCKKSR-SRDNGSACNSNGDQTESGGNGNSS---------GSGTNTSPSQPPAPDQ 439  Metarhizium a...
EHK43939      375 --ptagsELLREARILPQELHLA--GKKSR-SQDIGSASNSNRDQTESGGNGNGNg-------sSTGSNPSPPMPPPPEQ 442  Trichoderma a...
EHK24183      369 anlnpapEPMREARILPQEHQSGHTGKKSR-SQDMGSTSNSNGDQTESGGNGNSSgn-----gnGSGTNPSPPMPPPPEQ 442  Trichoderma v...
XP_003052072  367 ----tsqEPSREARILPLEQQSGHSGKKSR-SGGNGSASNSNGDNTESGGNGNST---------GSGTNPSPPTRPPPEQ 432  [Nectria] hae...
XP_011324674  365 ----sgkEPTREARILPNEQQPGHSGKKSR-SADNGSASNSNGDNTESGGNGNST---------GSGTNPSPPMTTLPEQ 430  Fusarium gram...
P19970        362 -----ppEGLREACIQLQD---GDNPRKNRsSKDNGSASNSGGDQTELGGTGTGSgdgs-gsggRTGNNTSPPGAIAPDQ 432  Neurospora cr...
EGY17172      369 -----hpEASREARIAEEP------SKKSR-SRDNDSTENSNGDQNETTGNVAVA---------RTSNSVSPPDATPAEQ 427  Verticillium ...
EQB45155      369 ----tqnEPSRQARIVASD------AKKGQ-SKDNTSATNSN-DQPDSGANSAVT-----------QQSTSPPDDSPPEQ 425  Colletotrichu...
ENH76664      369 ----phnEPSREARIGFDE-------KKGM-AKDNGSSSNSH-EQPDSGGNSAVT----------GEVSTSPPNRPPPEQ 425  Colletotrichu...
XP_008091539  369 ----gffEPSREARILGSE------EGKNR-AKDNGSTSN--GDQLDTGGNSAVA-------------GTSPPDPPFPEQ 422  Colletotrichu...
OBR16180      368 ----gfhEPSREARILTSE------GNKEL-AKDYGSMSHSNEDQPDSGGNSAVN-------------DTSPLDPIVPDQ 423  Colletotrichu...
EGR49196      451 RPTRPRDLDPDRVQIPSENMEYIRHLGLVPPELLPnppeRTYDDVHIDEDGWVYLNLLCNMAQLHIMNVTPDFVRKAVAD 530  Trichoderma r...
CCE27108      412 RPTRVKDLDPDRVQVPSENMDYIRHLGMVPPELLT----ESHKDVQPDADGWVYLNLLCNLAQLHIVNVTPSFVRNAVTE 487  Claviceps pur...
EFY91968      440 RPTRVKDLDPDRTQVPSENMEYIRHLGLVPPEIIPes-nKNNLDVQPDAEGWVYLNLLCNLAQLHIINVTPSFVRSAVNE 518  Metarhizium a...
EHK43939      443 RPTRPKDLDPDRIQIPSENMEYIRHLGLVPPELIPdp--pSEIDVHPDAEGWVYLNLVCNMAQLHIMNVTPDFVRTAVID 520  Trichoderma a...
EHK24183      443 RPTRPRDLDPDRVQIPSENMEYIRHLGLVPPELIAdppeRPSDDVHPDEEGWVYLNLLCNMAQLHIMNVTPDFVRNAVVD 522  Trichoderma v...
XP_003052072  433 RPTRPLDLDPDRTQVPAENMDYIRHLGLVPPELLAe---QHSNDVHPDAEGWVYLNLLCNLAQLHMINVTPDFVRSAVSG 509  [Nectria] hae...
XP_011324674  431 RPTRPLDLDPDRTQVPADNMDYIRHLGLVPPELLAv---QHNQDVHPDAEGWVYLNLLCNLAQLHMINVTPDFVRSAVTG 507  Fusarium gram...
P19970        433 RPTRPRDLDPDRVQIPSENMDYIRHLGLVSPEFLQgs-rTSYQDVAPDAEGWVYLNLLCNLAQLHMVNVTPSFIRQAVSE 511  Neurospora cr...
EGY17172      428 RPTRPLDLDPHRKQVPSENMDYIRHLGLVPPELLPv---HEVQDVASDADGWVYLNLLCSLAQLHIVNVTPDFIRTAVTE 504  Verticillium ...
EQB45155      426 RPTRPLDLDPDRLQNPTENMDYIRHLGLAPPHLTGl---TSYEDVSPDADGWVYLNLLCNMAQLHMLNVAPDYVRSAVTE 502  Colletotrichu...
ENH76664      426 RPTRPRDLDPDRLQNPTENMDYIRHLGLAPPYLTGl---ATYDDVSPDADGWVYLNLLCNMAQLHMLNVAPDYIRSAVSE 502  Colletotrichu...
XP_008091539  423 RPTRPLDLDPDRKQNPSANMDYIRHLGLAPPHLTGl---ATYEDVSPDADGWVYLNLLCNMAQLHMLNVAPDYIRSAVSE 499  Colletotrichu...
OBR16180      424 RPTRPLDLDPDRKQNPSANMDYIRHLGLAPPHLTGl---ATYEDVSPDADGWVYLNLLCNMAQLHMLNVAPDYIRSAVSE 500  Colletotrichu...
EGR49196      531 LSAKFQLSPDGRKIRWRGGTDGTKFSSDSSGDHSQRSPETDET-EITK-KERRKRQKTGRStg---dSWSPTNHLSNYGP 605  Trichoderma r...
CCE27108      488 ISTKFQLSPDGRKIRWRGCSEGTRFSSDSSNNSNQTTPDTREA-DEIIlEMPFKRQKTDNF------PEYESTSRTKFVP 560  Claviceps pur...
EFY91968      519 ISTKFQLSPDGRKIRWRGGRDGTRFSSDSSNESSQQSADTEDS-D----SGQRKRQKTGNFtaddvqSGGSSKSRSKFGP 593  Metarhizium a...
EHK43939      521 LSSKFQLSPDGRKIRWRGGTDGTKFSSESSGDSSQRSPETDDT-ENTK-KGHRKRQRTGRStg---dSGSSGNRPSKFGP 595  Trichoderma a...
EHK24183      523 LSAKFQLSPDGRKIRWRGGTDGTKFSSDSSGDHSQRSPETDDT-ENTK-ADHHKRQKTGRStg---dSGSSGNNLSKFGP 597  Trichoderma v...
XP_003052072  510 ISTKFQLSPDGRKIRWRGGTEGTRFSSDSSGYNSQKSPSTDDA-EEGS-EKKHKRQKTGRStgdefqSGSSSKNASRFDP 587  [Nectria] hae...
XP_011324674  508 MSTKFQLSPDGRKIRWRGGTEGTKFSSDSSGYNSQKSPSTDDT-EGGS-ESKRKRQKTGRStgdefqSGSSSKNGLKYDP 585  Fusarium gram...
P19970        512 KSTKFQLSADGRKIRWRGGTDGTKFSSDSSEDKSQQSPMTEDTeDGSDkNGRRKKRKTQQ----------ASSEIGRFGP 581  Neurospora cr...
EGY17172      505 KSTKFQLSHDGRKIRWRGGCDGTRFSSDSSGDGSRQSPSFEET-DGSNeEEPRKKSKKDQvag--evDPSSAHLSSKHNP 581  Verticillium ...
EQB45155      503 KSTKFQLSPDGRKIRWRGGTEGTKFSSDSSGDTSQMSRS-EDS-EGHEqDGQRKKRKATQQsksghySTSSAKHASDQFK 580  Colletotrichu...
ENH76664      503 KSTKFQLSADGRKIRWRGGTEGTRFSSDSSGDTSQMSRS-DES-DELAeDGQRKKRKMLMGtka-ghSNSSGMNTFDQFR 579  Colletotrichu...
XP_008091539  500 KSTKFQLSSDGRKIRWRGGTDGTKFSSDSSGETSHTSRS-EES-DAAN-DEHTKKRKRRQGpksglyPSSAGPNSSDQSK 576  Colletotrichu...
OBR16180      501 RSTKFQLSPDGRKIRWRGGTEGTKFSSDSSGDTSQTSPS-EGS-DPDAeTGHTNKRKRRHAsks--glSSAGQNPSDHLG 576  Colletotrichu...
EGR49196      606 ----QVSASTESFHYKPMFLHQQSPNEQSSMEDgTLS--SFGPIEESNA-ADSRWGQSGSgts-vrRKRRRDGAIIYYSG 677  Trichoderma r...
CCE27108      561 ----QMSTPPDCFHYKPLFARNNSPNGGTSLND-TLS--SFDPMEESNI-DGSREGLSGS------RKRRHDGAIIYYSG 626  Claviceps pur...
EFY91968      594 ----QVSASSNSFHYKPLFVHNSSPNGETSLDE-TLS--SFGPIDDSNG-DDSRWNLSGSgts-nrRKRRHDGAIIYYSG 664  Metarhizium a...
EHK43939      596 ----LMSAPSESFHYKPIFVNQPSPNAQSSMEDgTLS--SFGPLE-SN--TDSRWARSGSgas-nrRKRLRDGAIIYYSG 665  Trichoderma a...
EHK24183      598 ----QVSASSESFHYKPLFLHQQSPNEQSSMEDdTLS--SFGPIEESN--ADSRWGQSGSgas-nrRKRRRDGAIIYYSG 668  Trichoderma v...
XP_003052072  588 ----QLCAPSESFHYKPMFIQQDSSGGQTSLDE-TVS--SFGPPEDSNI-GESRWGLSGSgas-srKKRRHDGAIIYYSG 658  [Nectria] hae...
XP_011324674  586 ----QLCAPSESFHYKPLFAQQDSSGGQTSLDE-TVS--SFGPPEESNV-GESRWGFSGSgvs-srRKRRHDGAIIYYSG 656  Fusarium gram...
P19970        582 -----SRSPSDTFHYKPMFVHRNSSSIETSLEE-SMSqgSEDAVDESNM-GNSKWDFSGSgttqqrRKRRYDGAIVYYTG 654  Neurospora cr...
EGY17172      582 tllgKTSVSPDNFHYKPMFVHQSTSGGQSSMDD-TSS--SIGPVEDSNL-DDSRWGNSGSgts-lrKKRRRDGAIIYYNG 656  Verticillium ...
EQB45155      581 m--eRQMSSADSFHYKPLFMHQASSAEQTSLDD-TGS--SFGAGEESNN-GESRWGNSGSgst-rrKRRRLDGAIIYYNG 653  Colletotrichu...
ENH76664      580 l--dRCISSADSFHYKPLFLHQSSSAEQTSLDD-TGS--SFGAAEESNNgGESRWENSGSgss-rrKKRRLDGAIIYYSG 653  Colletotrichu...
XP_008091539  577 f--dPQMSSADSFHYKPLFVHQSSSAEQTSLDD-SNS--S-GAGEDSNN-GASRWGNSGSgsa-prKRRRLDGAIIYYSG 648  Colletotrichu...
OBR16180      577 s--gLKVSSIDSFHYQPLFVHHSSSGEQTSQDD-TSS--SFGAGDDSNK-GESRWGNSGSgsa-rrKRRRLDGAIIYYSG 649  Colletotrichu...
EGR49196      678 APFCTDLSGDPGDISPTTYMLSSSRDKVEs-pPHFDRPI-PFRSGSGSSIARLPLSDAD-LDLRSMSEMEVDDGKggvPD 754  Trichoderma r...
CCE27108      627 APFCTDLAGDSGDVSPATYMLSTGQDQPE---PKLERPH-AHRTDSGSSLPIRPLSDWN-QDRDSVMKMDVDGPEedvPD 701  Claviceps pur...
EFY91968      665 APFCTDLSGDPGDTSPATYMLSSGQDRQNs-qGQSSRPM-PYRSTSGSSLGYRPLGERN-HGIDTSFKMDIDSSDs-vPD 740  Metarhizium a...
EHK43939      666 APFCTDLSGDPGDISPTTYLLSSETGQSAsqkKQFLRPL-PFRSGSGSSLDRRPLSDAD-LGLGAISEMSMNDGAs-vPE 742  Trichoderma a...
EHK24183      669 APFCTDLSGDPGDISPTTYMLSSGRERLDp-qVQFARPI-PFRSGSGSSMTRRPLSDAN-LDLGSIPKLGVNDGVs-vPE 744  Trichoderma v...
XP_003052072  659 APFCTDLSGDPGDMSPTSQMLAASQHQASsdkTQLPMSP-PRRSNSGSFVNYRPLTDRGpLSTQPNPAMDVDMDD---PP 734  [Nectria] hae...
XP_011324674  657 APFCTDLSGDPGDMSPTTQMRAAGQTQSDkgsFKVPPSP-LRRTDSGSFLNYRPLTDRGvLSTQATTAMDIDSED---PP 732  Fusarium gram...
P19970        655 APFCTDLSGDPGDMSPTAQMTA-GREVEGsgsGDEVEHV-LQRTLSGSSLPIRPLSDDR-ARVAEVLDFDPGNP----PE 727  Neurospora cr...
EGY17172      657 APFCTDLSGDPGDTSPTSHMASSGQQKSSs-gPEFVRPDpPQRTTSGSALRFRPLSDNI-RAVTVAIRAEPEPTD---PY 731  Verticillium ...
EQB45155      654 APFCTDLSGDPGDSSPASYMTSAGQDQQLsssTGFLRPDlPHRTASGSALPYRPLSDGK-YVPSVAVGSEE--------- 723  Colletotrichu...
ENH76664      654 APFCTDLSGDPGDASPSSCVTSAGQDQQPt-aTGFLRPDpPHRTASGSALPYRPLSDGR-KVPSVAVATETE-------- 723  Colletotrichu...
XP_008091539  649 APFCMDLSGDPGDLSPSSYLTSTGQEQQSp-sSQNSRPG-PQRTQSGSALAYRPLTDDK-TASSVAVATE---------- 715  Colletotrichu...
OBR16180      650 APFCMDLSGDPGDTSP-SYLNSTGQDERTs-sADSSRPA-PCRTESGSALPYRPLTDGE-KAPSSAVVTE---------- 715  Colletotrichu...
EGR49196      755 LMTDSGDDSSEFNMDLCWSDAP-----QILEVRPLEPCGLGGVLPEDHFMVVVTTRRSKLDAYESQRK----KLSEEATe 825  Trichoderma r...
CCE27108      702 LATESESESGISELEPCWSTSQ-----QFMDFIPLEPCGLGGVMPDDHFMVIVTTKRHKDEMAFGQSSstcrRTSGTAA- 775  Claviceps pur...
EFY91968      741 LTGDSDSESSIPDSEFPWSSAQ-----QYIEVHPLEPCGLGGVMPDDHFMVVVTTKRPMTDATASEYQstipRKSEEATe 815  Metarhizium a...
EHK43939      743 LSTDSGDESSELDMEFSWGDKQ-----QTLEIHPLEPCGLGGVRPEDHFMVVVTTRRPMLDAHGGQSGvkrrKLSEEVTd 817  Trichoderma a...
EHK24183      745 LVTDSGDESSDISMDFPWSDTQ-----QILEVRPLEPCGLGGVLPEDHFMVVVTTRRSKLDAHLGQRSvdqhNLSEETTd 819  Trichoderma v...
XP_003052072  735 SLTEDTDDVSDIELDFEWTDNA-----QYMEYHPLEPCGLGGVLPEDHFMVVVATKRSKQDILPPTSRpdgrRVS-EGTd 808  [Nectria] hae...
XP_011324674  733 SLTDDTDDASDVDLDFTWSDKA-----QYMQHYPLEPCGLGGVLPEDHFMVVVSTKRSKQDELSSIQMag-gRIG-ESTd 805  Fusarium gram...
P19970        728 LVADDGSSPNDEDFVFPWCEDPakvriQPIAKEVMEPSGLGGVLPDDHFVMLVTTRRVVRPILQRQLSr--sTTSEDTAe 805  Neurospora cr...
EGY17172      732 LTTDDSD-DSEIEGSFLWSDSQ-----QFLTVQQLEPSGLGGVVPEDHFMVVCGTKRPKANTLPVQR-----EMSDTFAk 800  Verticillium ...
EQB45155      724 --TDSDDMDLEIEAELPWSDAT-----QPTPESSLDACGLGGVIPEDHFMVTVTTKRSKQDSPAASC-----KPGLQDVs 791  Colletotrichu...
ENH76664      724 --TGSDEVDSDIEADFPWSTSP-----QRPPSSKLDACGLGGVVPDDHFMVVATTKRPKADSVAATSC----KLKHGDLp 792  Colletotrichu...
XP_008091539  716 --MGSDDSDMDIEAEFPWSDRP-----QDLVANSLDACGLGGVIPDDHFRVIATTRRPKISATSSSSS----GLERNDVa 784  Colletotrichu...
OBR16180      716 --AGSVDSEMDIEADFPWSNVS-----QDVARSKMDACGLGGVIPDDHFMVVAITKRPKTDMLPPVSS----KVDPKNVt 784  Colletotrichu...
EGR49196      826 niigr-latmstSSPrpfvrrlrmqdePPKLQIEYLSGRIRRLEPVPLPPPAIFFPPFSS---DSWSEDESGSDGD-D-- 898  Trichoderma r...
CCE27108      776 ------------STP------------DARIEIEYLSGRIKRLAPVSLPPPVIFLPPFSSndsSSVDDDDADADDE-Edg 830  Claviceps pur...
EFY91968      816 fiisr-lasmstSSPaplat---sqqnFFPIEIDYMSGRIKRLAPVPLPPPVIFLPPFSTdtsSSGEDDFGSEDDD-D-- 888  Metarhizium a...
EHK43939      818 niihr-latmstSSPrplarqllskgdVPRIGIEYMSGRIKRLDPVALPPPAIFFPPFSV---DSWSEDEYGSDGD-D-- 890  Trichoderma a...
EHK24183      820 niinr-iatmstSSPrppvhrrpgaddSSKIKIEYLSGRIRRLEPVPLPPPVIFFPPFSA---DSWSEDGFGSDGD-D-- 892  Trichoderma v...
XP_003052072  809 siirr-latmstSSPvlgatktmsvsePPPIEIEYLSGRIKRLTPVALPPPAIFFPPFSAsdsTTDEDGETSDDPD---- 883  [Nectria] hae...
XP_011324674  806 avvrr-latmstSSPvsgalrslptmgPLPIEIEYMSGRIKRLTPVSLPPPAIFFPPFSPsesTVDSDDDMSDDMD---- 880  Fusarium gram...
P19970        806 fiaer-laairtSSPlpprs---hrltVAPLQVEYVSGQFRRLNPAPLPPPAIFYPPFSTdssWDDGDDLASDDEEvEev 881  Neurospora cr...
EGY17172      801 yvvnr-issqlsTNPlqkaapalgkspL--VEIDYVSGRIKRFAPMPLPPPSCFFPPFSTnteSSFDDSSSSGMED-Dv- 875  Verticillium ...
EQB45155      792 elvqr-iqlpanSLTsersshspltepSRCVSIQYTGRSVNKLNPAPLPPPGMY---FAFdsdSDESD---DSELD-Dtd 863  Colletotrichu...
ENH76664      793 siikritsplasSMPaeqtl--prsrpP--VSIQYTSRNVKKLAPMPLPPPGMY---FAFdsdSSDSESDTDSDVD-Ddv 864  Colletotrichu...
XP_008091539  785 nlvdritsplgsTSRvgllkpkskshlP--VTIEYTSRSIEKLNPAPLPPPGMY---FSFdsdSSGTSVEDVSEPE-D-- 856  Colletotrichu...
OBR16180      785 rivnritsplgsSSQaelrntefkgrsP--ISIEYTSRAIRKLNPTPLPPPGMY---FSFdsdTSETSDEYDSEFD-A-- 856  Colletotrichu...
EGR49196      899 ELNS-SEEFMSR---RANPHLSDG--YPDGV-LTSADEDGEEPEDDVAMPNdeadssglddlp--prnlgrilhsrGSTE 969  Trichoderma r...
CCE27108      831 GIET-SVELMRR---QANPRHSNG--YANMEaLSSGDQDDEEPGEDGGVKM-------------------------DDQM 879  Claviceps pur...
EFY91968      889 ALES-SEELMSR---AVNPHQSDG--YPDGVdLSSGDEDGEDPDEDDAANGmyeridmddvsnfkrpivsakrpsiGSAE 962  Metarhizium a...
EHK43939      891 ELNS-SEEFMSR---RANPHQSDD--YPDGVdLSSGDEDGEEPDDDVDMAVtedpasgmdg-----islqgprgsrASTE 959  Trichoderma a...
EHK24183      893 EFNS-SEEFMSR---RANPHQSDD--YPDGVdLSSGDEDGEEPDDDIEMSRnegrdsslddis-qqglgrvppgsrGSTE 965  Trichoderma v...
XP_003052072  884 DSPS-LRGIVGR---RIVPHHSDG--YPDGVdLSSGDEEGDDPDDSPDHNIydvsrdakvlp----nrprqtvrrtSSAA 953  [Nectria] hae...
XP_011324674  881 TSES-LRDLMGQ---RKLQHQSDG--YPDGVdLSSGDEEGDEPDDSPSQNMyaasrdpkalp----nrprqaarrtSSAA 950  Fusarium gram...
P19970        882 EEDSySEGQISR---RANPHFSDNntYMRKDdLAFDTETDVRMDSDDNRLSdsghn---------------mrammPRAE 943  Neurospora cr...
EGY17172      876 ----eSSRIADV---TPMHHQASIntYPENEdMTSGDEEGGEPDNGDEPRPthpgpdgpglm----lhqapvrrssSSAI 944  Verticillium ...
EQB45155      864 LDAR-SRPPMGN---RMLPHVFEDt-YPDDEeMSSGDEEGEEPDDADEPSEeagddsseeiki-pipprnarrtssSSAV 937  Colletotrichu...
ENH76664      865 DEPK-AGPAVSR------GRVLDIq-YPDDEeMTSGDEEGAEPDDDDEPSDkqdssddihvp---lptkamrrrssSSAV 933  Colletotrichu...
XP_008091539  857 ---E-PMALVGSfgvQGHPSTIENq-YPDDVdMSSGDEEDVEPDDGDEPVVkvddhssdgfai-pnlpraahrassSSAV 930  Colletotrichu...
OBR16180      857 ---L-PRAPVGS---RPYPTTFDNq-YPDNVeMSSGDEEDVEPDDGDEPLGksseesseevti-pilpreirrtssSSAV 927  Colletotrichu...
EGR49196      970 AVPGTIGGRSTSPH---VDGMLPAGGSSAATAgGGFESDYHSG 1009 Trichoderma reesei QM6a
CCE27108      880 DTDGDLRSEQQSSAgagVDGMLRTAASSVATA-GGVRSHYSSI 921  Claviceps purpurea 20.1
EFY91968      963 AAPGSIRRRSKSAS---ADAVFRTSGSSAATA-GGVESGHSSS 1001 Metarhizium acridum CQMa 102
EHK43939      960 AVPGT-RGRSNSAR---TEVLLHTGGSSAATAgGGVESGYNTS 998  Trichoderma atroviride IMI 206040
EHK24183      966 AVPGTIRGRSKSAS---AEAVLRAGGSSAATA-GGVESDYSSS 1004 Trichoderma virens Gv29-8
XP_003052072  954 AAAGTARGESKSTS---ADPALSSQDSSIATA-GAVGSGLSSS 992  [Nectria] haematococca mpVI 77-13-4
XP_011324674  951 AAAGTARGASKSNS---ANPALSHDASSVATA-GAAESGYSSS 989  Fusarium graminearum PH-1
P19970        944 AVDGDDSPLAAVTG---KEVDMLHTGSSVATA-GGAESGYSSS 982  Neurospora crassa OR74A
EGY17172      945 AAAGTARGRSKSTD------LPDSADSSNATV--DAESGYKSS 979  Verticillium dahliae VdLs.17
EQB45155      938 AAAGTIRGRSKSLS---AE-LPVTTGSSVATA-GGAESGYSSG 975  Colletotrichum gloeosporioides Cg-14
ENH76664      934 AAAGTVRGRSKSMS---AG--PAATGSSVATA-GGAESGYSSG 970  Colletotrichum orbiculare MAFF 240422
XP_008091539  931 AAAGTARSRSKSFS---AE-LLVGTGSSVATA-GGAESGYSSS 968  Colletotrichum graminicola M1.001
OBR16180      928 AAAGTARGRSKSLS---AE-LPGASGSSVATA-GGAESGYSSG 965  Colletotrichum higginsianum IMI 349063
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap