Conserved Protein Domain Family
Nop16

?
pfam09420: Nop16 
Ribosome biogenesis protein Nop16
Nop16 is a protein involved in ribosome biogenesis.
Statistics
?
PSSM-Id: 401393
View PSSM: pfam09420
Aligned: 116 rows
Threshold Bit Score: 70.0445
Threshold Setting Gi: 671410513
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003888663   5 RQRRKS---RSGAPKARlskfaNSK------LKKVTPRNFPGpLSN------------AYNPRQTPRQNYERLGLLSgkl 63  Puccinia gramin...
XP_002265366   3 gsRRKYkr-------------sKSKvqvalpRKNPRIFKPAFsVPPklraligdssdpKWDDQGTVIRNYKSYGVVS--- 66  wine grape
XP_006359382   3 gsRRKYkr-------------sRTKvrvglpKKNPNVFKPAFsLPPklrs----lvnsHWDDKGSVIDNYKSFGVVS--- 62  potato
XP_004342866   6 sKRKKHytvRAAVSSSKvkhrtARN------LRKVSVLHPDV--QA------------AWDKNKTLKENFASLGLVV--- 62  Capsaspora owcz...
XP_001999328   9 RKRYRYnvnRKTMNKTR---------------KNTGKIKDPE-MKK------------MWLEGKRVGTNFSEMGLAR--- 57  Drosophila moja...
XP_001989697   9 RKRYRYnvnRKTMNRTR---------------SSTGKIKDPE-MQK------------LWLEGKRVGTNFKEMGLAS--- 57  Drosophila grim...
XP_002043731   9 RKRYRYnvnRKTMNKTR---------------SSTGKIKDPR-MKK------------MWMEDQRVGTNFSEMGLAK--- 57  Drosophila sech...
XP_002070543   9 RKRYRYnvnRKTLNKTR---------------SSTGKIKDPV-LKK------------LWMEGQRVGTNFSEMGLAS--- 57  Drosophila will...
Q94402         5 vKKRGKpayTNRRNRQKylkkkDNK-------KKLSKSAVPI-IKY------------TWDETKTPRENVRDMGIAF--- 61  Caenorhabditis ...
CDP95947       6 hgRRKC---RRRINYSKnsaaaKKKam--krRKAMDGITCKQ-MRI------------AWDKNSTIKQNMKAMGLAY--- 64  Brugia malayi
XP_003888663  64 APRLaGGIEKKTDLqniwlnkykKKDEFeilrttsdgevvdneedenddeetdeddseksdddgnqatTVNRDPKLSKGE 143 Puccinia gramin...
XP_002265366  67 NPNLlGVRSRTPQI------------------------------------------------------------------ 80  wine grape
XP_006359382  63 NPNLlGVRCRTSHM------------------------------------------------------------------ 76  potato
XP_004342866  63 -----------------------DPNATl---------------------------------------QLRAEANLAASR 80  Capsaspora owcz...
XP_001999328     --------------------------------------------------------------------------------     Drosophila moja...
XP_001989697     --------------------------------------------------------------------------------     Drosophila grim...
XP_002043731     --------------------------------------------------------------------------------     Drosophila sech...
XP_002070543     --------------------------------------------------------------------------------     Drosophila will...
Q94402           --------------------------------------------------------------------------------     Caenorhabditis ...
CDP95947         --------------------------------------------------------------------------------     Brugia malayi
XP_003888663 144 GRIIRD-ADGKIIKVIIG-----------------------DESEI-ELEPTAEDPSKIViERdlqpststpwgnpldtp 198 Puccinia gramin...
XP_002265366  81 -------IETDSLQVPQPppppsdstdaa--vsefepldsgSDQEEdDLKS----------------------------- 122 wine grape
XP_006359382  77 -------IETDSLQVPPPkklpptsdddddadafedlddsgSEVEEdDLKS----------------------------- 120 potato
XP_004342866  81 GLLSNGdAPGSV-----------------------------------DLLALDAQAAADAaEAaa--------------- 110 Capsaspora owcz...
XP_001999328  58 -------DPNKAVGVPNYkrerleav-------kivngfteEALDDdEIAILGSKKDKIEsPK----------------- 106 Drosophila moja...
XP_001989697  58 -------DPNKSVGIPNYkrnrle------------svkivKKLDDdELARLDSKAQAAAeEAq---------------- 102 Drosophila grim...
XP_002043731  58 -------DVNKAIAIPSYkkdrllaa-------rvvngfleEELDEdERRVLGLKKPVVEeG------------------ 105 Drosophila sech...
XP_002070543  58 -------DPNKAVAIPNYksqrlqtv-------kivngfveEEMDDeEIKALKGSRVTESqE------------------ 105 Drosophila will...
Q94402        62 -------NPNDAVPIAEHr---------------------kEIIDAePIDGVSIVVPKPEkKVtgrk------------- 100 Caenorhabditis ...
CDP95947      65 -------DSNKLFPLEQSiskhceemeidelkpygsiksqmLKTKS---------------TVn---------------- 106 Brugia malayi
XP_003888663 199 syeqdpsvthhppapvlqgigyqnprqgfvPPKTKFVE---ELEKIS-----SNRlatyseTIKKKQHLSENQTNWLLKL 270 Puccinia gramin...
XP_002265366 123 -----------------------------------------ALGKKR-----RDG------KNAALKPLTTIQRLHVLKL 150 wine grape
XP_006359382 121 -----------------------------------------ALGKKR-----RDG------KSAPLQPLTTIQRVYISRL 148 potato
XP_004342866 111 ----------------------------gtPKVSEAVSvdgALEAKA-----AK-------TASAQVHQPPGVQEFVRAL 150 Capsaspora owcz...
XP_001999328 107 ------------------------------PKRGHVVQ---ELEQMA-----IDR------RADPEFRLPKGVVKELSYF 142 Drosophila moja...
XP_001989697 103 -----------------------------kPKRGHVVQ---ELEQMA-----IDR------RADPEFRLPKGVVKELTYF 139 Drosophila grim...
XP_002043731 106 ------------------------------PKRGHVVQ---ELEQLA-----SE-------RADPEFRLPKGVVKELSYF 140 Drosophila sech...
XP_002070543 106 ------------------------------PKRGHVVR---ELEQMA-----SE-------RADPEFRLPKGVVKELSYF 140 Drosophila will...
Q94402       101 ---------------------------kneKQAAHIIS---NLEQQVkeeeeARA------GQDRKFRLFHRETELCVYM 144 Caenorhabditis ...
CDP95947     107 -----------------------------kSKIAKVIT---ALEKEAee-ekIKQ------KKGRSYRLLARDIEFCIYM 147 Brugia malayi
XP_003888663 271 IEKHGlENTHLMARDLKLNKDQKTEGEIRHLISKL 305 Puccinia graminis f. sp. tritici CRL 75-36-700-3
XP_002265366 151 VEKYG-DDYQSMFMDTKLNSMQHSVGTLEKLCKRY 184 wine grape
XP_006359382 149 VEEYG-DDYQSMFMDTKLNKMQHSVATLEKLCKRY 182 potato
XP_004342866 151 MERHG-TNYKAMARDKELNYLQHTANQIRRKCTLY 184 Capsaspora owczarzaki ATCC 30864
XP_001999328 143 LNKHK-FNYKAMVSDRR-NHGQWTWRQFRLKIRRF 175 Drosophila mojavensis
XP_001989697 140 LGKHR-FNYRAMVADRR-NHGQWTWRQFRLKIRRF 172 Drosophila grimshawi
XP_002043731 141 LNKHK-FNYKAMVADRK-NFGQWTWRQFRLKIRRF 173 Drosophila sechellia
XP_002070543 141 LNKHK-FDYKAMVTDRR-NYWQWTWRQFRLKIRRF 173 Drosophila willistoni
Q94402       145 LARHG-EDFQAMTRDPK-NLWQYTPKQWAKKIRTH 177 Caenorhabditis elegans
CDP95947     148 IEKHG-GDYEKMSRDAR-NIYQDTSKQIERKIRIF 180 Brugia malayi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap