Conserved Protein Domain Family
DUF2009

?
pfam09418: DUF2009 
Protein of unknown function (DUF2009)
This is a eukaryotic family of proteins with unknown function.
Statistics
?
PSSM-Id: 401392
View PSSM: pfam09418
Aligned: 40 rows
Threshold Bit Score: 581.056
Threshold Setting Gi: 56472676
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004180058             156 SFIPMRLTYEERYLLKLLEATLEVSEYTNNVDILSYE-SKTKRIVKQLKELCSILSGLVIASNF---KIGLKLIENKE-Y 230 Tet...
WGS:AAFB:cds.EHI_148780A 146 RFIPLRITQPERKMLRLLEASLHVSKYSDKVDQIKLI-GKPQRLQEQLKGIASLLNGILIATQP---SEKEDYSDVLNtF 221 Ent...
CAM72770                   4 sqYPLRLTDLERQKLQLIVAALKVSEYTDDVDDFMRPyGKEGRMEAAMREFIDIVVGLAIASDAiprSVKNSFLAGEVkV 83  Lei...
Q4CS98                     4 eNVLLRLTDTEREDLQLLIAALKVSEYTDDVDDIRHPnSREERMYRCMRELFDTTLGLCIASGSvsrEVREEVARGNTdV 83  Try...
Q383U1                     4 ESVLLRLSDEEREELQLLIAALNVSEYTDDVDDIRRLsARDDRMCRCIRELFDTVLGLYVASGRvprEMKEGIASGRAsT 83  Try...
XP_001469225              34 EHIPLRLSPQERKIQRLMRGVILASSYTDKVDSASAL-KLKNRELLIVKELTNALTGLIVGLDM---RKAASFMRDHE-F 108 Lei...
Q4E4V2                    31 DYIPLRLNPRERKIQRLMRAVIMASHYTDKVDNEAVL-KSNKRDAIIVKEITNSLSGLITGLDV---EKGAKLLREKD-F 105 Try...
Q38DU7                    30 DYIPLRLNPKERKVQRLMRGIVMASHYTDKVDNESTL-KGNKRDSVIVKEVTSALSGLIVGLDV---EKGGALYRDKD-F 104 Try...
EFC40866                  20 KYIPIRLTFEERKKLRLLEATLTVSEYTDKIDTIRTF-GKLKRIKEQCEEICAILCGLMVAADY---QKGQELIANKN-F 94  Nae...
EFA84037                 370 KYIPVRLSLQERNLLRLLEASLHVSEYTDKVDIQISN--RPKRINDQLRHICAILCGLLVASDF---KKGQQLVEKKD-F 443 Het...
XP_004180058             231 KKFSNWFKKIFEIGRRYKIMNPEKMKSNYGKLVYILMDSMLPE-IESIMEF--NLYKPINTIESFLiennskntDNNEIY 307 Tet...
WGS:AAFB:cds.EHI_148780A 222 SQHEDILQAIFEIGRRYKIMNPDRMRDDYAKLIFILQDITVNS-INEELGV--SLLRPVETVYRYL--------ERKDLL 290 Ent...
CAM72770                  84 ATVVPLLEDLFEIMRRHKRLNPFSHRGEFGKLMMMLQDVQKRS-IQRALEIqsTLVIPVRTVEAAL--------SSIHCE 154 Lei...
Q4CS98                    84 RLTISILIGLFEIFRRHKRLNPFSNRSEFGKLTMLLQDVQKRS-IQERLHIshSLLIPVQTVGMEL--------RRVGAE 154 Try...
Q383U1                    84 QMTLKILPSLFEIFRRHKRLNPFSNRSEFGKLTMLLQDLRKPT-VQQRLEIchSLIIPVKTVGGEL--------QRVGAE 154 Try...
XP_001469225             109 TPYQHEIRAAIEMCRRYKMMNPDLLRTDYVKFLYMIQDAVQSDmAREALGF--NVVKELVTVGRYC--------ETHNMQ 178 Lei...
Q4E4V2                   106 SPFAREIQLAVEASRRYKMMNPDFLRTDYVKFLYMVQDAVQNEnVREMLGF--VVAEQIVTVGFYC--------RALGFE 175 Try...
Q38DU7                   105 TPFARDIQSAVETYRRYKMMNPDLIRTDYVKFLYMIQDAVQNQnVKEALGF--PVAERIITVGRYC--------SYLGVE 174 Try...
EFC40866                  95 QDNEEFFQDVFEIGRRYKIMNPEKMRGTYGKLCYIIQDSQQPE-VQEMLGF--KLDRPVKTVHWFL--------EQHDAL 163 Nae...
EFA84037                 444 SDNEMFFQTVFEIGRRHKIMNPAKMRAEYGKMIHLLQDSSQRE-IRDALGL--ELVSDLKTVYAVL--------EECDGL 512 Het...
XP_004180058             308 QMFRDNLILDATSYISSIGKTRTQINKLIKKKESAIETLANKYGKINgFDDEKIRQIIYSIDDFNTYTFMNRTPILRMQR 387 Tet...
WGS:AAFB:cds.EHI_148780A 291 KILDDELIEIAVSEIIPDNKSKSQIQDEIKRKENAIKVIAKKYSTMN-CDEEEIKQCLYSIADNNCYLRYNRDPVVKTIH 369 Ent...
CAM72770                 155 TLADDEAVRT------------DYLKRTGTEKQAGMQSLIERYSKGDgHKKEIIEHCLRSIDDVYSFIQSNTRPLRTLRR 222 Lei...
Q4CS98                   155 ELLTDRDVD-------------KYLVTHGTEKAAVLQKLLDRYGGs--ECKPVVERCLRSIDDVSQFIEGNVRPLRWLRQ 219 Try...
Q383U1                   155 AMLRDPDLG-------------EYLNSFDKNKVTAFDRLLGRYGG---AESSTVERCLRSIDDVHQFLESNIRPLVWMRN 218 Try...
XP_001469225             179 DILQDTRLPHCITPV-PVMKDRNMLNRCLRGKDVVVGKLVKQYASEHrMHEDNVEVVVRSLNDANCFSNDNVETSERLLE 257 Lei...
Q4E4V2                   176 SILQDNRMPLCITPV-PFIKNRNKLNKALRHKDVTVNGLLKEYSRASgRTLDEVEIAVRSLNDANHFANDNVDSTNQMLH 254 Try...
Q38DU7                   175 DMLQDKRLPLCITPV-PFMKKRSKLNEALRRKDVTVSSVVKEYSRKSgRSQDEVEIAIRSLNDANQFANENVESTNELLN 253 Try...
EFC40866                 164 EILEDKDIDTATNEIFANGKTRMQVEEEIKMKEKAAKRICKVYSESCeMEEEDIEKCLYSIGDSSAYLRQAVYPVETILS 243 Nae...
EFA84037                 513 KLLSDPLLDVATREVLPDGKQRHEIQHDIKVKERAIKMLSNKYASST-LSTDQIEQCIYSIGDNHTYLRENRDSVRKMIK 591 Het...
XP_004180058             388 RLDLFLEPEIMKKY--PIGIKYGRGGSKLTHDHSKQYHYVQQSLMIWSIVQREMIHLWYLADLD-LFS-TTHYQLANTGH 463 Tet...
WGS:AAFB:cds.EHI_148780A 370 YLEKYFDPNEAKEPrfSLAINEGNEGSRLSHDHAKQFLFVKQTLVLWNIILENMYQLWILAELD-LFDpQHPYEMKNTGQ 448 Ent...
CAM72770                 223 WLSRDFEPLPSDNAy-SISIRHGRSGACFTHSHATHCQYVTESLLLWENVQKNILNLWEAAEDDmLVEgQGQYVVANTGQ 301 Lei...
Q4CS98                   220 IILEEFLPLDGNPKy-DLSIRAGVNGAKFSHDHKRHCQYVVESLTLWENVQRNIFDFWQVSEDDmLIDgDGHYTFVNTGQ 298 Try...
Q383U1                   219 IISEEFCPLDKNCKy-NLAIQQGVDGSLLTHEHSVQCAYVIESLSLWIKVQQSIFEFWQVSEDDmLIDgSGQYSLVNTGQ 297 Try...
XP_001469225             258 LLKQYFTPISCTELt-SLAIDEGADGSRLTHNHKMQYIFVLQSLSLWKNMCRKMYLLWSLAEED-MLNpNEKYELRMTGQ 335 Lei...
Q4E4V2                   255 LLKEFFSPDAPTDLt-NLSIEEGENGSRLSHNHRRQYFFVLQSLSLWKNICRRMFSLWTIAEGD-MLNpNEPYEFRYTGQ 332 Try...
Q38DU7                   254 LLLQHFSPNNVTEAt-DLNIVEGEGGSRLTHNHRRQYFFVLQSLSLWKNICRRMFSLWTIAEED-MLNpNEPYEFRSTGQ 331 Try...
EFC40866                 244 FLLNNFKRDDYEDGh-SLAIMAGHEGARLSHNHAIQFDFVYQTLTLWKNVGRDMFELWFLAERD-LFSsTHTYSLRNTGQ 321 Nae...
EFA84037                 592 YLKTYFDPENEEQYf-SLRITPGQAGARLNHSHQKQYMYVYQSLTLWKKILHDMFRLWYLAEYD-LLR-GNSYSLRNTGQ 668 Het...
XP_004180058             464 GLNRIKACPLIYKEMVKIIGECKMSSK-EWIGSSVIHLGDHAVPNALFFLDKYIQIPNILMPFDNTINKIDEYVSh---- 538 Tet...
WGS:AAFB:cds.EHI_148780A 449 GYHRLQQSPRISLVMHRIVKEMQEKVG-NWVGSAQIHLGDHNVPNALVFIDKYTQISRFLGPIITTLENLEKIGEk---- 523 Ent...
CAM72770                 302 GFHRMCSAPRSYGVMSRLVRDTEQRMG-GWVGIKVIHLGDRDVPNPLVFIDKYTVIPRLVKPVVQTLHALRYVFHeedee 380 Lei...
Q4CS98                   299 GFHRMCRAPKSYSRMARCVNEADQEMG-GWVGIKVIHLGDRDVPNPLVFIDKYTVIPRIVQPIMHTIMEIEKIFSpss-- 375 Try...
Q383U1                   298 GYHRLCHARKSYARMSRVVNETEHQLG-RWIGIKVIHLGDRDVPNPLVFIDKYTVIPRIVQPIMHVMMALEKIFSpda-- 374 Try...
XP_001469225             336 GLQRVQKAPQLFKAIQQVLQETKEELG-EWVGSERIHLGDDQVPNAFHFIDKYGQVSRIIIPILRTLGHIDHLER----- 409 Lei...
Q4E4V2                   333 GYQRVQKAPNLYRAISEVVQQTKDELG-EWVGSDRIHLGDDQVPNAFHFIDKYAQVSRIIIPILRTIAHIDTLAE----- 406 Try...
Q38DU7                   332 GYQRVQKAPNLYNAIHEVVQETKKELG-EWVGSERIHLGDDQVPNAFHFIDKYGQVSRIIIPILRTVSHIDKLEE----- 405 Try...
EFC40866                 322 GLNRVQYCPNVRRAMEKLLSQTQNSTS-SWVGSSVIHLGDDAVPNSLMFIDKYTQISRILNPIIQTITEIDNYMIk---- 396 Nae...
EFA84037                 669 GLNRIQAAPKISSAMGKILHSAQTKVGqYWVGSSVVHLGDHNVPNALTFIDKYTQISRILNPIVIAIDFIPKIK------ 742 Het...
XP_004180058             539 -------------DVFFSEYITKEYGSTKDLKLIILQDSFTHMFDGSGADNFFMSGSCIDGRLTSAWNFCNELSKKKYYN 605 Tet...
WGS:AAFB:cds.EHI_148780A 524 -------------NAHVKNYIIKTFGSYEELRMIILTDFFKHAFDGSGADNFYDAGSCIDGRLTSAWNWCSSVDKKEYYP 590 Ent...
CAM72770                 381 eegqpqvvheydnYPGLRNLLRSKYHSYGELMMMILSDFFKHAFDGSGDD----GGSCIDGRLTSAWNWCHQLHKKKYYD 456 Lei...
Q4CS98                   376 ----------peeHPGLRNFFRAKFNSYKALRMMILSDFFRHAFDGSGDD----GGSCIDGRLTSAWNWCHQLEKKSYYD 441 Try...
Q383U1                   375 ----------keeHPGVRNFLRSKYSSFPELRMTILSDFFRHAFDGSGDD----GGNCIDGRLTSAWNWCHQLHKKSFYD 440 Try...
XP_001469225             410 -------------HAEHAAYLREVWGGGEQAKRAILRDFFRHGFDGSGGDNMDDAGSCIDGRLTSAWNWCNNIRFKEFYP 476 Lei...
Q4E4V2                   407 -------------SYEHNAYMKEVWDGSMNAKRAILRDFFRHGFDGSGGDNMDDAGSCVDGRLTSAWNWCNNIRWKPFYP 473 Try...
Q38DU7                   406 -------------SPEHKAYVKEIWGSPTGAKLAILRDFFRHGFDGSGGDNMDDAGSCVDGRLTSAWNWCNSIRFKPFYP 472 Try...
EFC40866                 397 -------------DQNLKEYINTTFGGPEEAKMTILIDLFRHGFDGSGADNFFMAGSCIDGRLTSAWNFCSKINKKNYFP 463 Nae...
EFA84037                 743 -------------DPGLQTYILNTFGSQKNLVKLILSDFFKHAFDGSGADNFFDAGSCIDGRLTSAWNWCSKIEKKNYYS 809 Het...
XP_004180058             606 IFLLTGFTGFNG 617 Tetrapisispora blattae CBS 6284
WGS:AAFB:cds.EHI_148780A 591 IFQLAGFTGFDG 602 Entamoeba histolytica HM-1:IMSS
CAM72770                 457 AFVLTGFAGFD- 467 Leishmania infantum JPCM5
Q4CS98                   442 AFVLTGFSGFD- 452 Trypanosoma cruzi
Q383U1                   441 AFVLTGFNGFD- 451 Trypanosoma brucei
XP_001469225             477 LFLFSGFSSFDG 488 Leishmania infantum JPCM5
Q4E4V2                   474 LFLLAGFSSFDG 485 Trypanosoma cruzi
Q38DU7                   473 LFLLAGFSSFDG 484 Trypanosoma brucei
EFC40866                 464 LFLLGGFIGFDG 475 Naegleria gruberi
EFA84037                 810 IFLLSGFNGFDG 821 Heterostelium album PN500
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap