2WJV,2XZL


Conserved Protein Domain Family
UPF1_Zn_bind

?
pfam09416: UPF1_Zn_bind 
RNA helicase (UPF2 interacting domain)
UPF1 is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD).
Statistics
?
PSSM-Id: 401391
View PSSM: pfam09416
Aligned: 46 rows
Threshold Bit Score: 190.537
Threshold Setting Gi: 56473310
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WJV_A         7 HACSYCGIHDPACVVYCNTSKKWFCNGRGNT-SGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPA 85  
A0C1B9        30 llfSYCLQSDVNAVAQCLTCKRWYCNS--ATkSGSHIILHLIKNKHSQISLHSKNKVEITTIECYGCEQKNLFTLGQVNG 107  Paramecium tet...
EAY17561      46 pCCSYCLCDIPECLVKDKAIGRWFCNGRGKA-LHSHIIHHLVKSRHMEIELPPQNPYSQIPMTCYLCHSTNIFRLSFVQS 124  Trichomonas va...
XP_001323558   5 pKCQYCGCEAEGSLAQCAATGLYFCNGKGDT-LQSHLVHYLRTCHLDKIILPKCNPFSGISLKCYVCGSENVFRLGFIHS 83   Trichomonas va...
Q582F1        28 pSCSYCSEESPTCLAFCNGCSKWFCNGSNGT-SGSHIILHLVKSGHNSLKLHAENSLGDSTLECYICRSSNIFSLGFMPS 106  Trypanosoma br...
CCC67331      70 HACAYCGVDSPTCVIKCNSCNKWFCNSKNGT-NSSHIVNHLVLSHHNVVSLHPDSDLGDTILECYNCGCKNVFLLGFVSA 148  Naumovozyma ca...
XP_002619682  89 EACSYCSTSDPASLARCGTCQRWFCNGSSSK-AGSHIVAHLVHSKHSEISLHEQSALGGDPLECYNCGSRNVFALGFVAA 167  Clavispora lus...
XP_013932413  16 dACAYCGISEPDSLVKCNTCEKWFCNGKTSG-AGSHIITHTVLSKHQSLSLHPDSELGDTMLECYNCGNRNIFVLGFVSA 94   Ogataea parapo...
XP_002492883  55 HACKYCGVSNPRCVVRCDICKKWFCNGKSGT-T-SHIISHMVLSRHHEVSLHSDSDLGETELECYSCGNKDPFMLGFVSA 132  Komagataella p...
2XZL_A        12 nSCAYCGIDSAKCVIKCNSCKKWFCNTKNGT-SSSHIVNHLVLSHHNVVSLHPDSDLGDTVLECYNCGRKNVFLLGFVSA 90  
2WJV_A        86 KADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLR-AR--QITAQQINKLEELWKEN 158 
A0C1B9       108 TNKENILILCRG-CLPLRQLGEITWDSNDYQPLIKDKSIQEWLL---GQGDKIN-SR--MVTLERINQYEEERKKk 176  Paramecium tetraur...
EAY17561     125 QKTGKYFVLCRE-CCNDPQLHLYSLDLAHRQLIVQQTQMLEWLVRPPSHAESKDgFRfcDITPTDMDLLEETWPKN 199  Trichomonas vagina...
XP_001323558  84 -SNQQIFLACRSPCQFHESLISRGVDNSTFQPLISNGDVIHDVIPPPLQDQY---AKipLVKAIQICesvkrtlag 155  Trichomonas vagina...
Q582F1       107 KEEAVVVLVCREPCLHSKTLRDLNWDSSTWLPLIEERRLLPWICSIPSTL-----RR--PLTLHDIKALEMSWEQk 175  Trypanosoma brucei
CCC67331     149 KSEAVVVLLCRMPCAQTK---NVNWDTDQWQPLIEDRQFLSWVAEEPSEEEKLK-AR--LITPSQISKLEAKWRSN 218  Naumovozyma castel...
XP_002619682 168 KQESVVVLLCRMPCAQAR---DINWATNEWQPLVEARALLPWVAA------QREpAR--DVKPAQMARLEAQWRvk 232  Clavispora lusitan...
XP_013932413  95 KTDSVVVILCRLPCAQSK---NVEWNTANWQSLIEDRALLPWVAKPPSEEEKLE-AQ--PITSLQITKLETKWKQD 164  Ogataea parapolymo...
XP_002492883 133 KTDTIVVILCRIPCSQAK---DSDWNTANWQPLVEERCFLDWIADYPTPLDMAN-AR--AISPLDISKLERQWRSD 202  Komagataella phaff...
2XZL_A        91 KSEAVVVLLCRIPCAQ---TKNANWDTDQWQPLIEDRQLLSWVAEQPTEEEKLK-AR--LITPSQISKLEAKWRSN 160 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap