5I08,5X5C,5GYQ,5XLR


Conserved Protein Domain Family
Spike_rec_bind

?
pfam09408: Spike_rec_bind 
Click on image for an interactive view with Cn3D
Spike receptor binding domain
Spike is an envelope glycoprotein which aids viral entry into the host cell. This domain corresponds is the immunogenic receptor binding domain of the protein which binds to angiotensin-converting enzyme 2 (ACE2).
Statistics
?
PSSM-Id: 401384
View PSSM: pfam09408
Aligned: 20 rows
Threshold Bit Score: 159.585
Threshold Setting Gi: 656462531
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5I08_A        326 PSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDI 405  Human coronav...
YP_009072440  371 PSPAFWRRHYVRNCNYDISVFTDNADVYSLQCYGVAPSSLADMCWEEAHIDYMKISEKDIFSFKPSGAGDFAKYNYKLPS 450  Bat Hp-betaco...
AIA62352      399 PQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSF 478  BtTp-BetaCoV/...
5X5C_A        377 PQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSF 456  Middle East r...
YP_009273005  376 PSPAAWVRATISNCTFDFESLLRTLPTYNLKCYGISPARLSTMCYAGVTLDIFKLNTTHLSNMLGSVPDAVSIYNYALPS 455  Rousettus bat...
ABN10935      367 PQPIAWRRYAVSKCGFDFEAVINRLPTFELKCFGVSPARLASMCYGKVTIDVFRINVTHLANLIAGVPDAFSKYNYALPR 446  Bat coronavir...
ADM33566      365 PQPIVWKRHTVTNCSFDFDAIVNRLPTFQLKCFGVSPAKLAQMCYSSVTLDIFRANTTHLANMLGKVPDVFSKYNYALPP 444  Bat coronavir...
ABN10927      359 PQPIVWRRYTVSSCSFDFESIVNNLPTYDLKCYGVSPARLAQMCYAGVTLDVMRINKTHYSNLIGNVPDLFTKYNYALPT 438  Bat coronavir...
5GYQ_A         17 PQPVVWRRYMLYDCVFDFTVVVDSLPTHQLQCYGVSPRRLASMCYGSVTLDVMRINETHLNNLFNRVPDTFSLYNYALPD 96   Rousettus bat...
AID16716      339 PNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPD 418  Bat SARS-like...
5I08_A        406 SSSSCQLYYSLP--LVNVT---INNFNPSSWNRRYGFG---S---FN-------LSSYDVvysdHCFSVNSDFC--PCAD 465  Human coronav...
YP_009072440  451 DFMGCTVVFTNQelTCNATsgqLCHVYTNNLTNYPAEAtawDkshYEsieryqmWSSENVynceLQEVGPQQFNrmPRNC 530  Bat Hp-betaco...
AIA62352      479 AHPTCRVLASVP--PNVT----ITKP---------------EaygYIskc--srLTGDYQhietPLYINPGEYS--ICRD 533  BtTp-BetaCoV/...
5X5C_A        457 SNPTCLILATVP--HNLTT---ITKP---------------LkysYInkc--srLLSDDRte-vPQLVNANQYS--PCVS 511  Middle East r...
YP_009273005  456 NFYGCVHAY-----------------HLNSTTP-YAVAvppGay----------------------pIKPGGRQ--LFNS 493  Rousettus bat...
ABN10935      447 DFYGCVHAF-----------------YVNMSSD-YIIA---DswpAVv-------------------IQPGGRQ--TDSS 484  Bat coronavir...
ADM33566      445 DFYGCVHSY-----------------YINDSSRMYAIA---QqwpATv-------------------IAPGGRQ--PYNS 483  Bat coronavir...
ABN10927      439 NFYGCVHAY-----------------YINVTDGRYALA---ThypATv-------------------ITPGGRQ--PYNS 477  Bat coronavir...
5GYQ_A         97 NFYGCLHAF-----------------YLNSTAP-YAVA---Nrf----------------------pIKPGGRQ--SNSA 131  Rousettus bat...
AID16716      419 DFTGCVIAW-----------------NTAKQDI--------GnyyYRs-------------------HRKTKLK--PFER 452  Bat SARS-like...
5I08_A        466 psvvn----------------------------------------scakSKPPSAICP 483  Human coronavirus HKU1 (isolate N5)
YP_009072440  531 yvrsnnsndywqpmsf-----------------rgvnslmvamaitlkpTRTSATVCG 571  Bat Hp-betacoronavirus/Zhejiang2013
AIA62352      534 faplgfsedgqvfkrtltqfeggglligvgtrvpmtanlemgfvisvqyGAGTDSVCP 591  BtTp-BetaCoV/GX2012
5X5C_A        512 ivpstvwedgdyyrkqlsplegggwlvasgstvamteqlqmgfgitvqyGTDTNSVCP 569  Middle East respiratory syndrome-re...
YP_009273005  494 fvsqvldsptsqct---------------------pancmgvvvigltpASGSNLVCP 530  Rousettus bat coronavirus
ABN10935      485 lvgtwlnspakshct--------------------ilscfgvaviglqpASGTQLVCP 522  Bat coronavirus HKU9-4
ADM33566      484 yvgtvlntpnptct---------------------qltcfgvvvislkpASGKHLVCP 520  Bat coronavirus HKU9-5-2
ABN10927      478 yvatvlntvnnwct---------------------rancfglvviglkpASGRQLVCP 514  Bat coronavirus HKU9-3
5GYQ_A        132 fidtvinaahyspf----------------------syvyglavitlkpAAGSKLVCP 167  Rousettus bat coronavirus HKU9
AID16716      453 dlssddgngvytlstydfn-----------pnvpvayqatrvvvlsfelLNAPATVCG 499  Bat SARS-like coronavirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap