Conserved Protein Domain Family
DUF2003

?
pfam09404: DUF2003 
Eukaryotic protein of unknown function (DUF2003)
This is a family of proteins of unknown function which adopt an alpha helical and beta sheet structure.
Statistics
?
PSSM-Id: 401380
View PSSM: pfam09404
Aligned: 5 rows
Threshold Bit Score: 730.9
Threshold Setting Gi: 156222005
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1L8F9         8 EELRPVPKERAVLESFFTQLGMFWFDRAKDYVEKEKDASKS--AGAIWGSLLAALAHLAAAEKAYHNMTFLGQKLGGQSF 85  zebrafish
Q4RGT9         5 EELRPVPRERAILESFFTQLGMFSFDRAKDYVEKEKDNSKS--AGAIWAALLAALAHLAAAEKLYHNMTFLGQKLGGQSF 82  spotted green p...
Q6P1I3         8 AA--PVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANKS--AGGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGGQSF 83  house mouse
XP_002609421   9 SSLPPVSIEQAFLETYFHALSQFAYDKAKEFAEKDRDSRKTn-YGSTWTSLLNSLSHLAMAEKMYASLGYLGQK----KW 83  Florida lancelet
EDO42854       3 pfqPPVSQERAILETFFHALSQFAFDKAKDQVEKERDSRKTlaQMSMWVSVLNSLSHLASAEKIYFSLAFIARK------ 76  starlet sea ane...
Q1L8F9        86 FSRKDSIRTIYTSLHNELKKVVSMGRHAPGGSTPNLEELLPHLSEQLCHFTQARMEIADFYEKMHTLGSQKTVNSEELVG 165 zebrafish
Q4RGT9        83 FSRKDSIRTIYTSLYNELRKVVTMGRNSQPSSAFCLEDLLSHLSEQLCHFIQARMEMADLYEKMHSLGSQKSINSEELLT 162 spotted green p...
Q6P1I3        84 FSRKDSIRTIYTSLHNELKKVVA-GRGAPGGTAPHVEELLPHLSEQLCFFVQARMEIADFYEKMYALSTQKFINTEELVS 162 house mouse
XP_002609421  84 FSGRESLRSTYSSLLTELRKIEDTGRQAVGGTAPSLEKLLAHLCGQLSSFVAARLETMDFYETLCSMGSSRVIGYSDVAV 163 Florida lancelet
EDO42854      77 FFRKDTLRDMYKTLLVELKKTSEVTPVASHSVLLVEGSLLAELSRHLTQFVQARMELMDFYEVMASIAVSPVVNYTDLVI 156 starlet sea ane...
Q1L8F9       166 ALDSILQKYSSRFHHPILSRLESSFQVEVDVLTQLLRCQAQISEWHFLPSLLNLHGAHSKLQAWGQVFERQRETRK---- 241 zebrafish
Q4RGT9       163 TLEAVLHKYSTKFHHPILGRTEEGFQTEVDVVTQLLRCQAQVSEWSFLPALLSLHGAKSKLTTWGQLFQRQKETRK---- 238 spotted green p...
Q6P1I3       163 TLDTILRKYSSRFHHPILSPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTKLQSWGQTFEKQRETKK---- 238 house mouse
XP_002609421 164 NLAAIIQRHSKSFHHPILTPLKTSFSDELSILYHLIQAQADMSIWCFLPALLHLHEAHSKLNSWGAIVQMAKEQSQkkgf 243 Florida lancelet
EDO42854     157 MVDELIHRHQNCFHHPILDPVKSSFSFEVEILLHSLRAQCEMCELKFLPSLLHLHASHTKLTSWSQLLPALNSKES---- 232 starlet sea ane...
Q1L8F9       242 HLFGGQSQKAVQPPHLFLWLQRLQATLLAKFSFYFHEALSRQTSQSEMKTLTARTSLDYFGKISGFIRKYDASNVSLVFD 321 zebrafish
Q4RGT9       239 NLFGGQSQKAVQPPHLYVWLQRFQAALLAKFSFYFHEALSRQTAPADMKALTARTAPDYHGRICSFVRRHDASNVSLVFD 318 spotted green p...
Q6P1I3       239 HLFGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGKISSFIRKYDAANVSLIFD 318 house mouse
XP_002609421 244 ELFGSASTKVPQVPPLHQWLLSFKAALVSKFSLYFNETLSKQSSPPEMKTLLAKTSCDYMAKFATFLRKSDATNLSIVLD 323 Florida lancelet
EDO42854     233 -LFSSGPKKQMETPFLYLWISKLHAALVSKFTLYFYPVLTEQTTTADMKVLTARATVDYIAKITAFQRRSDALNVSVLLD 311 starlet sea ane...
Q1L8F9       322 NRGS-ESFQGHGYHHPQSYREAPKGVDQFPAVVSLPGgERPVTHWPNVIMIMSDR--STELNTLDKVVHFYDDKVQSTYF 398 zebrafish
Q4RGT9       319 NRGS-ESFQGHGYHHPHSYREAPKGVEQFPAVVSLPSgERPLTHWPNVIMMMGDR--AAELNTLEKVVHFYDDKVQSTYY 395 spotted green p...
Q6P1I3       319 NRGS-ESFQGHGYHHPHSYREAPKGVDQYPAVVSLPS-DRPVMHWPNVIMIMTDR--ASDLNSLEKVVHFYDDKVQSTYF 394 house mouse
XP_002609421 324 TRGLeETYRGHGYHHPAAKTEPPKGLDSYPAIVSVPG-ERPQHHWPNLIMIMNNN--AADMNTMERIVYFYDKTFQSTYY 400 Florida lancelet
EDO42854     312 ARGL-DSYSSDGYHFPQDKRDQPAGLGAFPAVVSFPG-ERPLEHWPNIISIMMDRahAQDLASAEKVVYFFDNRVQSTYF 389 starlet sea ane...
Q1L8F9       399 LARPEPHFTIVVIFDGRKSERDSYIVAFLQELIGSLRNSKPFTSLKPGSK 448 zebrafish
Q4RGT9       396 LSRPEPHFTLVVIFDGRKSEKDLQITAFLQEICGSLRNSKPFSTLKPGSK 445 spotted green pufferfish
Q6P1I3       395 LTRPEPHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLKPGSK 444 house mouse
XP_002609421 401 MMRIEPKMTLVVIFETKRAEKDSYVNTFLTEIGSQLKNNKLLLNLKPGSK 450 Florida lancelet
EDO42854     390 LTRIDSRLTLVVIFNSKRNEKDSYITSFMSDMALHLRNTKVFAMLKPGAK 439 starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap