2G7J


Conserved Protein Domain Family
DUF2002

?
pfam09400: DUF2002 
Protein of unknown function (DUF2002)
This is a family of putative cytoplasmic proteins. The structure of these proteins form an antiparallel beta and sheet and contain some alpha helical regions.
Statistics
?
PSSM-Id: 401377
View PSSM: pfam09400
Aligned: 8 rows
Threshold Bit Score: 200.741
Threshold Setting Gi: 238870936
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2G7J_A            1 MYLRPDEVARVLEKAGFTVDVVTNKTYGYRRGENYVYVNREARMGRTALIIHPRLKDRSSSLADPASDIKTCDHYQNFPL 80 
ACR70647          1 MYLRPDEVAQVLQRAGFTRDSVSDQAYGFHKGEHYVYVNREVRLGRTALLIHPALAQRSLRFAQPSAVQRSSPAYVRFPP 80  Edwardsiella...
jgi:Rahaq2_0811   1 MYLRPDEVARVLENSGFERDFIDDKAYGYRRGEHYVYVNREARFGRTALVIHPALKERSERFAEPTASFRSSEAYKNFPL 80  Rahnella aqu...
CAX60969          1 MYLRPDEVARVLEGAGFEMDAVTARAYGYRRGDNYVYVNREARMGRTALIIHPVLKEKSHGFAHPASDMKACEEYVQFPM 80  Erwinia bill...
P0AD53            1 MYLRPDEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNREARMGRTALVIHPTLKERSSTLAEPASDIKTCDHYQQFPL 80  Escherichia ...
BAN98075          1 MYLRPDEVARVLEKAGFEMDVLTPKTYGYRRGENYVYVNREARMGRTALIIHPTLKEKSQHFAEPASEMKTCDHYTQFPL 80  Plautia stal...
WP_025421159      1 MYLRPDEVARELENSGFERDTITRQSYGYRKGHHYVYVNREARLGRTALVVHPALRDKSSLFAEPTSPVRASVSYQAFPP 80  Sodalis prae...
WP_002212216      1 MYLRPDEVAKVLENAGFERVYTVNEAYGYQKGRHYVYVNRESYMGRTALIIHPSQKDKSIGLSMPTALIKTSNKYIEFPL 80  Yersinia pse...
2G7J_A           81 YLGGETHEHYGIPHGFSSRIALERYLNGLF 110
ACR70647         81 DPDAASPAFIGVPHGFTSRERLNHYLAQMF 110 Edwardsiella ictaluri 93-146
jgi:Rahaq2_0811  81 DVSSDNETYYGICHGFSSRQILASYLDNVF 110 Rahnella aquatilis CIP 78.65 = ATCC 33071
CAX60969         81 YLAGENQDHYGIPHGFSSRAALERYIVNMF 110 Erwinia billingiae Eb661
P0AD53           81 YLAGERHEHYGIPHGFSSRVALERYLNGLF 110 Escherichia coli K-12
BAN98075         81 YLMGDSQEHYGIRHGFSSRMALERYLQGVF 110 Plautia stali symbiont
WP_025421159     81 DPEGQPDSHYGIPHGFSSRASLVRYLQKMF 110 Sodalis praecaptivus
WP_002212216     81 YLVGAIGEYYGIAHGFSSRELLLNFLGRMF 110 Yersinia pseudotuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap