Conserved Protein Domain Family
DUF1999

?
pfam09390: DUF1999 
Protein of unknown function (DUF1999)
This family contains a putative Fe-S binding reductase whose structure adopts an alpha and beta fold.
Statistics
?
PSSM-Id: 370462
View PSSM: pfam09390
Aligned: 10 rows
Threshold Bit Score: 160.75
Threshold Setting Gi: 503222877
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Deipr_0847       10 YRLLLPDDYAALAELDLAAQHELDPGFGGLPEREREGRLSTSLGALKFYERTDHSFVAV-RDGAVAGMVLAQSVWQGDKP 88  Deinococ...
jgi:Dgeo_1073         3 YRSFAEPDYEALQALDLAAQRRADPAFDALPDRERAGRLSTSLPALKFYERSEHSFVAQdEAGQLQGLILAQHVWQGDRP 82  Deinococ...
Q9RV36                6 YRQFSQPDFEVMQALDLAEQRRTAPEYDVLPEREQEARLSSSLAALRHYERSGHSFVAEgQDDHVRGYVLAQSVWQGDRP 85  Deinococ...
zhongguo:DGo_CA1412   4 FRTLTEHDYDALAALDLAAQRALDPAFDTLPDRERESRLSTSLPALKFYERSEHSFVADgEGG-LRGFVFAQSVWQGDRP 82  Deinococ...
WP_013457538          3 FRFLEEPDFAELQALERRIFPGRPEAF-----------YRTAPAALRYYARSGHSFAAV-DGERLLGFVLAQAVWQGDRA 70  Oceanith...
AEB11802             14 YRPFDEQDFPAMEAFERALLEGAPEHA-----------YRAHPAALRFFMRTGHSFVAS-TRDAVHGFALAQAVWQGDRP 81  Marinith...
jgi:Mesil_2124        3 FRDFAEPDFARLEAYEKAKLGEQPPHV-----------YRCTPAGLRFFSRSGHSFMAL-EEERIVGFALAQALWQGDQV 70  Meiother...
WP_013557902          3 YRTFHEPDFDALQALEARVLRAEDPNFDALAEREREGRVRTSLAALKFFERSEHSFAAA-EGGTLHGVILAQSVWQGDRP 81  Deinococ...
jgi:Deipe_2346        3 YRAFTPADFGPLVDLDLTVLRREDPLFDTLSEREREGRVRTSLAALRFYERSEHSFVAE-EDGELRGAIFAQSVWQGDRP 81  Deinococ...
ACO45709              4 YRTFGEADHAALQALDLRVQRHTDPSFDSLPEREREGRLHTSLPALKFYERSEHSFVAQdPQGTLQGFVFAQPVWQGDRP 83  Deinococ...
jgi:Deipr_0847       89 IVLVRTLLTDPAlPEAlraEVYSGLLRALFKSAYDTAVYEVhfv--phrRWPLAADLGDV------RRLGDYGVRYLGSR 160 Deinococ...
jgi:Dgeo_1073        83 IVLVRAVILAPD-APE---DTAAGLLRATVKSAYDSAVYEV--------HFPLLPALEAAarreeaRLTGGYAVCHLGTR 150 Deinococ...
Q9RV36               86 AVFVRALVLDDA-QDE---DMRRGLLRAVVKSAYDAAVYEV--------HLPVTPELHAAaraeeaHLTGQYAVIHLGTR 153 Deinococ...
zhongguo:DGo_CA1412  83 LVFVRTLALAPGlTPElvdEAARGLLHAVVKSAYDTAVYEI--------HLPLTAELANAaraeeaRVVGQYGVVHLGTR 154 Deinococ...
WP_013457538         71 TVLVTRIAAESA-------EVYAGLLRALIKSAYDANAYEVallaepgdRPELDRALADAqladsgRRL---HTRVLGGR 140 Oceanith...
AEB11802             82 TVFVTRILAADG-------AAYEGLLRAVVKSAYDAGVYEVamhi-dpeHEALVAAAQAAgftlgpLVL---ATRVLGSR 150 Marinith...
jgi:Mesil_2124       71 TVLLTRILADAQ-------EVYQGLLGAVVKSAYDAGVYEValhl-dpaHTELKSALEAHsfvlgpKIL---AVRVLGSR 139 Meiother...
WP_013557902         82 IVLVARALIAPD-APA---DTAAGLLRACVKSAYDAAVYEV--------HFPLTDGLEDAaradgaYVTGQYAVRHLGTR 149 Deinococ...
jgi:Deipe_2346       82 TVLVTRLWLARP-ADA---DVTSGLLRACSKSAYDAAIYEL--------HLGVTAELQEGaarehfREQGVYAVRLLGSR 149 Deinococ...
ACO45709             84 VVLMRTLTLSPD-APA---GTAAGLMHAVVKSAYDTAVYEL--------HYPLTPALLDAaqqegaNVIGQYAVQHLGSR 151 Deinococ...
jgi:Deipr_0847      161 EETA 164 Deinococcus proteolyticus MRP
jgi:Dgeo_1073       151 AATA 154 Deinococcus geothermalis DSM 11300
Q9RV36              154 AESA 157 Deinococcus radiodurans
zhongguo:DGo_CA1412 155 AQTA 158 Deinococcus gobiensis I-0
WP_013457538        141 GARG 144 Oceanithermus profundus
AEB11802            151 GVRG 154 Marinithermus hydrothermalis DSM 14884
jgi:Mesil_2124      140 GQRQ 143 Meiothermus silvanus DSM 9946
WP_013557902        150 AETA 153 Deinococcus maricopensis
jgi:Deipe_2346      150 ADSA 153 Deinococcus peraridilitoris DSM 19664
ACO45709            152 NGTA 155 Deinococcus deserti VCD115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap