Conserved Protein Domain Family
Porin_OmpG

?
pfam09381: Porin_OmpG 
Outer membrane protein G (OmpG)
Porins are channel proteins in the outer membrane of gram negative bacteria which mediate the uptake of molecules required for growth and survival. Escherichia coli OmpG forms a 14 stranded beta-barrel and in contrast to most porins, appears to function as a monomer. The central pore of OmpG is wider than other E. coli porins and it is speculated that it may form a non-specific channel for the transport of larger oligosaccharides.
Statistics
?
PSSM-Id: 401363
View PSSM: pfam09381
Aligned: 7 rows
Threshold Bit Score: 422.232
Threshold Setting Gi: 282948847
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wugsc:SARI_03140  59 SKPWKVRAGLLIETENKEGQSfDKDGFFEPTLWMDFSRDRWTFYGSYYQETHGTN--YSDGfSRDNWFNQYEFDARYLMV 136 Salmonella ...
EFE95271          49 EKTWHITTGLLIETENVEGQS-DNKGFWEPTLYLEAARGNWSIYGSFYQENHNGAhyYGTQ-GRSDWFNQYEINLRYLIA 126 Serratia od...
KMK09401          47 RE-WQIKTGLLLETENIEGNS-DGKGAWEPSVYLELIKDRWTLGGSFYQEDHNTShyYRLK-GRNDGYDQYEITARYALV 123 Pluralibact...
WP_015698845      50 AEPWKVQIGAMQETENTEGQG-DKDGAYEPTVFVNFSKGKWNFYGAFYQEDHNVD--YSED-TRSDWFNQVEFDAHYQFV 125 Rahnella aq...
jgi:Sterm_2344    71 WDGWHGTFGILQETENVEGSG-DKDGLYEPSVYFDLRKGKWSFGMTNYNENHDFD--YSDW-TRGNYLNRLELRAHYQFT 146 Sebaldella ...
CBG88448          24 NNDWHFNVGAMYEIENVEGQGeDMDGLAEPSIYFNAANGPWKISLTYYQEG-PVD--YSAG-TRGSWFDRPELEVRYQFL 99  Citrobacter...
WP_002435624      26 ETRWEYTLGAMYETENVEGQAeDMDGLYEPSVYFNAAYGPWSINLAMYQEG-PVN--YSAM-SRGTWFNRPEFNLRYQFI 101 Atlantibact...
wugsc:SARI_03140 137 DQKDLALGMTFHFRNYTFIYQDNPEKTqsgGYNSQRWSFQPDWRINFTDKFKSTGWVTVYNWYNNLHENGLANRELKGEG 216 Salmonella ...
EFE95271         127 SHAVYDLGLMAGVRHYQWQYKQQDGIT---RYQTQRYTVQPDWEIRLGDQSRFSGWLALYQYINHVRQNALTDKELEGET 203 Serratia od...
KMK09401         124 TSKTLALGMMGGIRNYRWSYYTGDNKGq--tYNTQRYTLQPDWNLQLIPDLHFSGWLAMSQFKNNVNRNGLTHNEIESET 201 Pluralibact...
WP_015698845     126 DNADYALGLMLGFRNYQWQYNDDKKKDd-kSYHTQRYTVQPDWSVSLSPALKYNGWMALYNYYNNMDNNGYLNKEFEGET 204 Rahnella aq...
jgi:Sterm_2344   147 DNDKYAVGLGAALRNYQWFHKDGTSPTt---tNNRWLNIQPDWRYNFTSNLSYEGWLGLYSMFNDAQENGYSDKELETES 223 Sebaldella ...
CBG88448         100 ESDAVSIGLTGGFRNYGYHYVNEPGKD---TANMQRWKVQPDWDIKISDDVRFGGWLSMYQFVNDLSTTGYADSRVETET 176 Citrobacter...
WP_002435624     102 DNPDYTLGFTGGIRNYGYHFKNADGSPa-gTANTLRYKIQPDWRAKLHGNLTFEGWLAWYRFINDLEQTGYSDSRVETET 180 Atlantibact...
wugsc:SARI_03140 217 GFEYRFNPTIAVRLNYFIDRGWNTNSdDQTGEFCRSQLRPYIPITFSLFDaGPTTITPYGRWTLDVWS---QNASRNQRM 293 Salmonella ...
EFE95271         204 GFGYQVNDLLSFKLNYYIDRGWNSGS-DRLAEFSQQELRLYMPLTLALWH-TPLTVTPYLRHSLDTDY---YNVEQQRND 278 Serratia od...
KMK09401         202 GINFAFNETLGVTLNYYIDRGWNKYS-ERDGEFSQQEMRLYFPVIFNLFSvNESKFSPYIRRTLTTWY---YNHDHQRNE 277 Pluralibact...
WP_015698845     205 GLKYSFTDDIALQVSYYLDRGWNTGD-SQRGEFAKQEARVYLPLSVDLFTsGKTVLTPYARRTLDTYY---YNDDRGERE 280 Rahnella aq...
jgi:Sterm_2344   224 GLKYKFNDFISVRLNYYLDRGWNLGG-PTENSFNNQQIRGYVPMNFAFFGeKTTTITPYFRQGFINKS---WNAGANQAN 299 Sebaldella ...
CBG88448         177 GFTWSINDTFSVVTNYYLERGFNLDSsRNNGEFSTQEIRAYLPIAL-----GNTTLTPYTRIGLDRWSnwdWQDDIA-RE 250 Citrobacter...
WP_002435624     181 GFTYQFNDTVSLQVHYYLERGYNASDsHKQGEFNTNEARIFLPVSL-----GSTTLTPYTRLTIDRWSnwdWQEDGADSE 255 Atlantibact...
wugsc:SARI_03140 294 HTTETRTGIFIEQKLSPHLSMTLDYAYEVQARHDLSPGDKPIVKFHKTGLGFIY 347 Salmonella enterica subsp. arizonae s...
EFE95271         279 GETDTRIGLLLEQTLPQGIALSLEYAYELQRHHGTADDAGSNGKYHYTGVGLSY 332 Serratia odorifera DSM 4582
KMK09401         278 RERDSRFGLLFEQALPHNLALSLEYGYELQLHPDASGNEPSRTKFHYTSIGLSY 331 Pluralibacter gergoviae
WP_015698845     281 GETDTRFGLLINQPLPNGFAISLEYAYELQLHDNTDASANAKTKFHYTGVGVTY 334 Rahnella aquatilis
jgi:Sterm_2344   300 NEIDTRLGLRIDQQLPAGFAVSLEYAYEMRNQQDSAPGQKSFSKFHYTGVGLSY 353 Sebaldella termitidis ATCC 33386
CBG88448         251 GHDFNRLGMLYAYDFQNGLSMTLEYAFEWQDHDEGDSD-----KFHYAGVGVNY 299 Citrobacter rodentium ICC168
WP_002435624     256 DHDYNRLGLLVAHDFNNGLAMTLEYACEWQTHREGDTHD----IFHYAGIGVSY 305 Atlantibacter hermannii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap