Conserved Protein Domain Family
DUF1997

?
pfam09366: DUF1997 
Protein of unknown function (DUF1997)
This family of proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 401350
View PSSM: pfam09366
Aligned: 124 rows
Threshold Bit Score: 94.4773
Threshold Setting Gi: 122157764
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFJ52778         20 PLAEYMALPASQYSVL-DARRIERVDDSTFRCYVGELRFFSWSVEPVITVSVTVEPgGC-----TIRLLD-------CKL 86  Volvox carte...
Q2JPW9           43 TLARYLRGHAQWIQRCfRPLQVEALSAETYRLQFFRMGGLGFELEPSFGVKIWPDK-DY-----RFCLTS-------IEL 109 Synechococcu...
ASGPB:GKIL_1411  23 pLVTYLRGPDHWVPVGfRPLKVQRTGAGHFDLQLPEFGALGFQLAPRMVLQLIEDD-EC-----RYRLLS-------VPS 89  Gloeobacter ...
XP_002289552     98 sITKWLSNDRAIAMSIwDEKLITEVEPQVYRLKLMTLMFVTIQLAPHVDVRMWTEGtNTdetatTFKLESvafdpniQIL 177 Thalassiosir...
XP_002500381     82 SLERWIQRPENVMEVVfSKEGVIPRESGEWRISVIKLPFLDWELNPEFDLRVLPKDaAAre--fGVRMVSd-----aLRF 154 Micromonas c...
XP_003059109    102 SLERWTRTPRNVMGVVfTADDIAELREGTWRVQVTRMPLLQWELSPEFDLRVLPPEaSTip--gGVRMQSd-----aLRF 174 Micromonas p...
CAK29221         41 SVSDYLDAHQEWFTRCaAPMTVQPLDVNAYRLQLGKFGNFGFEVEPKIDLVLLPQQ-QG-----VYRIETla---paLPV 111 Synechococcu...
jgi:Cyagr_2084   49 VVGAYLDRHEGWFRRCaAPMTVEPIGSQGYVLTLGRFGNFGFEVEPTIGLELLPQA-AG-----VYRIVT-------VPL 115 Cyanobium gr...
WP_011932223     41 VVARHLDRHDDWFRRCaAPMQVEALDAQTYALTLGRFGNFGFEVEPTIALRLLPGH-EG-----TYAIET-------VTQ 107 Synechococcu...
Q7V4T6           39 NVAAYLDHHQGWFQRCaAPMEVKALDDQSYLLTLGRFGNFGFEVEPCIGLKLLPQQ-QG-----LYQIIN-------VDL 105 Prochlorococ...
EFJ52778         87 QGSRFVedi---ndKFSA--TMTNVVRYRDYQPpageeeeevetdqghgawqqqqeeeaaaalpsrsatggpsRKEILSD 161 Volvox carte...
Q2JPW9          110 PGDEGM--------PYRV--SCQADFRLEELQGslk----------------------------------dlpTTRVHWS 145 Synechococcu...
ASGPB:GKIL_1411  90 PAS-----------DYQT--DFSGLFQLTPRPP----------------------------------------AVDVFWE 116 Gloeobacter ...
XP_002289552    178 PGVGVSad----slGILI--DVVGELYPSKDG------------------------------------------RAVEGK 209 Thalassiosir...
XP_002500381    155 APEGGLeklppgfaGMDIwsYIDCELFIERLPDdddgta----------------------------gggarsRTAVCAD 206 Micromonas c...
XP_003059109    175 ADANSAerlppgfkDMDLweRIDATLYVDRDGGggg----------------------------------ggdAAAVCAD 220 Micromonas p...
CAK29221        112 DE------------GYNV--DFQASLKLCPQEQ----------------------------------------HTLVQWE 137 Synechococcu...
jgi:Cyagr_2084  116 PDSDAAlr-----gLYDV--EFAASLRLDEASGsevshee---------------------------vdgvmlHTLVRWQ 161 Cyanobium gr...
WP_011932223    108 PDRDPAla-----aLYDV--DFQAGLTLNDDTHqg------------------------------------lpTTCVRWE 144 Synechococcu...
Q7V4T6          106 THQDLPlc-----dHYDV--DFKAGLKLEPSETeasn--------------------------------tvqqTTIVNWD 146 Prochlorococ...
EFJ52778        162 TTIQVCVEVPPWSGFLPVATIEGVGSNVMQNVLKVMVPRFLAQLRTDYELWA 213 Volvox carteri f. nagariensis
Q2JPW9          146 LHLEIGLALPRFLQVLPRKLVYRVARQVVQQVTRGMSDRLTHNVCSDFYRSI 197 Synechococcus sp. JA-2-3B'a(2-13)
ASGPB:GKIL_1411 117 ARFAIQLTLPGFLGMFPQPVVQSAAQTAVSAMSASVCQNLVHNICCDYRSRh 168 Gloeobacter kilaueensis JS1
XP_002289552    210 IGFVTKGELPPPMRLLPEQALKGSLSTINRTITKFAMDSFQQGARTKYRQFL 261 Thalassiosira pseudonana CCMP1335
XP_002500381    207 IDLLIAADIPGVFRWIP--FFEGIGESAIAGSIESVGEFAQANVQAAYEEWV 256 Micromonas commoda
XP_003059109    221 LDVQIAADIPSFLRLIP--YFEKIGESAIGTSIDIVGAGARTRVQDAYVRWT 270 Micromonas pusilla CCMP1545
CAK29221        138 LDLSVGIRLPAFIGVLPEALVQSSGDHLLRQIVRQISRRLTWKVQEDFHAHa 189 Synechococcus sp. RCC307
jgi:Cyagr_2084  162 LDLAVWLRLPGMLSLLPEHLVQSSGDHLLRQIVRQISRRLTWKVQEDFHASH 213 Cyanobium gracile PCC 6307
WP_011932223    145 LDLSIWISLPKVITMLPEGLVQSSGDRLLRQIVRQISRRLTWKVQEDFHGSH 196 Synechococcus sp. WH 7803
Q7V4T6          147 LDLSVWIQLPKVITLLPDGLVQTSGDQLLRQVVRQISRRLTWKVQEDFHATH 198 Prochlorococcus marinus str. MIT 9313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap