3AHJ


Conserved Protein Domain Family
XFP_N

?
pfam09364: XFP_N 
XFP N-terminal domain
Bacterial enzyme splits fructose-6-P and/or xylulose-5-P with the aid of inorganic phosphate into either acetyl-P and erythrose-4-P and/or acetyl-P and glyeraldehyde-3-P EC:4.1.2.9, EC:4.1.2.22. This family is distantly related to transketolases e.g. pfam02779.
Statistics
?
PSSM-Id: 401348
View PSSM: pfam09364
Aligned: 6 rows
Threshold Bit Score: 679.953
Threshold Setting Gi: 15214331
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AHJ_A  36 PVSEEAIEGMDKYWRVTNYMSIGQIYLRSNPLM---KEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFI 112
P74690  22 PLDPTELNQMHGFWRAANYLAVGMIYLRDNPLL---REPLQPEQIKHRLLGHWGSSPGISFLYTHLNRIIRKFDQDMLYM 98  Synechocystis sp. PCC...
O74770  50 KITDEEVANVHRFQRACDYLAASLIFLSNGLYT---GGDLEEKDIKTRLLGHWGTCPGLSIVYSHCNRIINKYDLNMLFV 126 Schizosaccharomyces p...
B8DUT6  16 pVSEEAIEGMDKYWRVANYMSIGQIYLRSNPLM---KEPFTRDDVKHRLVGHWGTTPGLNFLLAHINRLIADHQQNTVFI 92  Bifidobacterium anima...
Q97JE3  13 KITPEYLKKIDAYWRAANFISVGQLYLLDNPLL---REPLKPEHLKRKVVGHWGTIPGQNFIYAHLNRVIKKYDLDMIYV 89  Clostridium acetobuty...
Q9CFH4   4 YNSEAYLKKLDKWWRAATYLGAGMIFLKENPLFsvtGTPIKAENLKANPIGHWGTVSGQTFLYAHANRLINKYDQKMFYM 83  Lactococcus lactis su...
3AHJ_A 113 MGPGHGGPAGTSQSYVDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAVMNNP 192
P74690  99 VGPGHGAPGFLGPCYLEGSYSRFFAECSEDEDGMKRFFKQFSFPGGIGSHCTPETPGSIHEGGELGYCLSHAYGAAFDNP 178 Synechocystis sp. PCC...
O74770 127 VGPGHGAPAILSALFLEDSLGPFYPRYQFTKEGLNNLINTFSLPGGFPSHVNAEVPGAIHEGGELGYALSVSYGAVLDRP 206 Schizosaccharomyces p...
B8DUT6  93 MGPGHGGPAGTAQSYIDGTYTEYYPNITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSHAYGAIMDNP 172 Bifidobacterium anima...
Q97JE3  90 SGPGHGGQVMVSNSYLDGTYSEVYPNVSRDLNGLKKLCKQFSFPGGISSHMAPETPGSINEGGELGYSLAHSFGAVFDNP 169 Clostridium acetobuty...
Q9CFH4  84 GGPGHGGQAMVVPSYLDGSYTEAYPEITQDLEGMSRLFKRFSFPGGIGSHMTAQTPGSLHEGGELGYVLSHATGAILDQP 163 Lactococcus lactis su...
3AHJ_A 193 SLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFVagfd 272
P74690 179 NLIVVGLAGDGESETGPLATSWHSNKFINPIRDGAVLPVLHLNGYKINNPSVLSRISHEELKALFEGYGYTPYFVE---- 254 Synechocystis sp. PCC...
O74770 207 DLIVTCVVGDGEAETGPTATSWHAHKFLDPAESGAVIPVLELNGYKISERTIYGCMDDSELLSLFSGFGYEVAIVN---- 282 Schizosaccharomyces p...
B8DUT6 173 SLFVPCIIGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANPTILARISDEELHDFFRGMGYHPYEFV---- 248 Bifidobacterium anima...
Q97JE3 170 DLITACVVGDGEAETGPLATSWQANKFLNPVTDGAVLPILHLNGYKISNPTVLSRIPKDELEKFFEGNGWKPYFVE---- 245 Clostridium acetobuty...
Q9CFH4 164 EQIAFAVVGDGEAETGPLMTSWHSIKFINPKNDGAILPILDLNGFKISNPTLFARTSDVDIRKFFEGLGYSPRYIE---- 239 Lactococcus lactis su...
3AHJ_A 273 N----EDHMSIHRRFAELFETIFDEICDIKAAAQ---TDDMT-RPFYPMLIFRTPKGWTCPKF-------IDG--KKTEG 335
P74690 255 G----SDPESMHQAMAATLDHCVSEIHQIQQEAR---STGIAvRPRWPMVVMRTPKGWTGPDY-------VDG--HKVEG 318 Synechocystis sp. PCC...
O74770 283 D------TPDQNRVMAATMDWAVERIHDIQHRAR---VNREEiKPRWPMIILRTPKGKGCPKY-------LNG--KFLEG 344 Schizosaccharomyces p...
B8DUT6 249 AgfdnEDHLSIHRRFAELFETIFDEICDIKAAAQ---TDDMT-RPFYPMLIFRTPKGWTCPKF-------IDG--KKTEG 315 Bifidobacterium anima...
Q97JE3 246 G----EDPETMHKLMAETLDIVTEEILNIQKNAR---ENNDCsRPKWPMIVLRTPKGWTGPKF-------VDG--VPNEG 309 Clostridium acetobuty...
Q9CFH4 240 Ndd-iHDYMAYHKLAAEVFDKAIEDIHQIQKDARednRYQNGeIPAWPIVIARLPKGWGGPRYndwsgpkFDGkgMPIEH 318 Lactococcus lactis su...
3AHJ_A 336 SWRAHQVPLASARDTEEHFEVLKGWMESYKPEELFNADGSIKDDVTAFMPKGELRIGANPNANGGVI 402
P74690 319 FWRSHQVPMGGMHENPAHLQQLEAWMRSYKPEELFDEQGTLKPGFKAIAPEGDKRLGSTPYANGGLL 385 Synechocystis sp. PCC 6803 substr....
O74770 345 TFRAHQVPLKLARTDTNQRNLLKDWLNSYNCQDFLDEHGLPTKGITEHLPPREKRMGQRHETYNSYL 411 Schizosaccharomyces pombe 972h-
B8DUT6 316 SWRAHQVPLASARDTEAHFEVLKGWMESYKPEELFNADGSIKEDVTAFMPKGELRIGANPNANGGRI 382 Bifidobacterium animalis subsp. la...
Q97JE3 310 SFRAHQVPLAVDRYHTENLDQLEEWLKSYKPEELFDENYRLIPELEELTPKGNKRMAANLHANGGLL 376 Clostridium acetobutylicum ATCC 824
Q9CFH4 319 SFRAHQVPLPLSSKNMGTLPEFVKWMTSYQPETLFNADGSLKEELRDFAPKGEMRMASNPVTNGGVD 385 Lactococcus lactis subsp. lactis I...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap