5Y6I,2G7U


Conserved Protein Domain Family
HTH_IclR

?
pfam09339: HTH_IclR 
Click on image for an interactive view with Cn3D
IclR helix-turn-helix domain
Statistics
?
PSSM-Id: 401326
View PSSM: pfam09339
Aligned: 81 rows
Threshold Bit Score: 44.7054
Threshold Setting Gi: 81774763
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Y6I_A  18 SAEVGTDILKALAELSPATSLSRLAEHVGMPASKVHRYLQALIASGFAVQDA 69  Pseudomonas aeruginosa
P16528  26 SLTRGLKLLEWIAESNGSVALTELAQQAGLPNSTTHRLLTTMQQQGFVRQVG 77  Escherichia coli K-12
Q82LL3  23 SLERAFDLLERMADAGGEVGLSELSASSGLPLPTIHRLMRTLVACGYVRQQP 74  Streptomyces avermitilis
Q9F3D9  24 SVQRAFRLMEAVGAHESGVPAKQLARETGLALGTTYHLLRTMVHDGYVRKLE 75  Streptomyces coelicolor
Q829M3  14 SAVRTVELLEYFAGRPGMHSLAAVQEAVGYPKSSLYMLLRTLVELGWVETDA 65  Streptomyces avermitilis
Q89VH4  19 SLDRGLRLLQCFGTTVGPMTLSDLARAADLPRATARRMLFTLQRGGFVGGDG 70  Bradyrhizobium japonicum
Q9I6X7  35 SLARGLAVIHAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLMQLGYATTDG 86  Pseudomonas aeruginosa
O83046  33 GISKGMAILDSFGTDRHRLNITMAAEKTGMTRAAARRHLLTLEYLGYLESDG 84  Acinetobacter baylyi ADP1
Q43992  25 GLAKGLALLEAFGIDRQRLNVTQVAERTGISRTAARRYLKTLKFLGYLDTDE 76  Acinetobacter baylyi ADP1
Q2YKQ1   9 gfAKGLRVIEALGEDRPRLSIADVSKITGLDRATARRCLLTLAELGYAEYDG 60  Brucella abortus 2308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap