1F0X


Conserved Protein Domain Family
Lact-deh-memb

?
pfam09330: Lact-deh-memb 
D-lactate dehydrogenase, membrane binding
Members of this family are predominantly found in prokaryotic D-lactate dehydrogenase, forming the cap-membrane-binding domain, which consists of a large seven-stranded antiparallel beta-sheet flanked on both sides by alpha-helices. They allow for membrane association.
Statistics
?
PSSM-Id: 401318
View PSSM: pfam09330
Aligned: 59 rows
Threshold Bit Score: 332.971
Threshold Setting Gi: 220975879
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1F0X_A       278 VFYIGTNQPEVLTEIRRHILANFENLPVAGEYMHRDIYDIAEKYGKDTFLMIDKLGTDKMPFFFNLKGRTDAMLEKVKfF 357
Q7V9S2       275 VFFVGTNNAEHLTHLREKILTNMNSLPDMGEYMHFSYFDGSAKYCKDTFLFLKYFGTKYLPKLLEAKRYIDQLTGQVTfL 354 Prochlorococcus...
WP_014704174 275 VFYIGTNDSTVLAKMRRDILSEFDNLPVSGEYLSREYYDVCKKYGKDTFLVIDKLGSKYIPKLFSLKRTVDRIAGNFKfL 354 Methylophaga fr...
WP_012070441 276 VFYIGTNDPAVMEQMRRDMLSTFKNLPVSGEYMHNSSYDISKKYGKDSYLVIDKLGTKYIPKMFALKRTVDRWAGKLKfM 355 Marinomonas sp....
WP_013663082 276 VFYIGTNDPAVMEQIRRDMLSKFDNLPVSGEYMHKTCYDISKKYGKDSYLVIDKMGTKYMPKMFAMKRTVDRIASKFSfL 355 Marinomonas med...
CAX57933     273 TFYIGTNDETELVALRRYLLEGLSELPLQAEYIHRDAFDLTVRYAKHMYWAINRFGPEALPQLMANKAKWDIRVKNLKvL 352 Erwinia billing...
WP_012804158 277 TFYIGTDRPADLESLRRAFLAADGPLPISGEYMSSHAFDLAVEYGKDTYVSLKHAGSRTLVRMFALKSWANGVFAKLSgM 356 Brachybacterium...
Q8NRY8       279 VFYIGTNNTHELEEIRRLFLEADMPLPISGEYMGRSAFDLAEKYGKDTFVFLKFMSPALQTRMFSFKTWANGLFSKIPgI 358 Corynebacterium...
Q0C1N1       263 VFHVATDDAGVLSDVRRRMLGQAALVPISAEYMHRDTFRMAEREGKDLLLAVRTAGADRLPFLFGFKAGVDGVARWLGfG 342 Hyphomonas nept...
WP_013039750 277 TFYIATNDAAVFTSLRRAALGTFSHLPVSAEYLSRETILMSERYGRDSFFAIKYLGTRRLPRLFALKRALDRAARWIGiG 356 Sphingobium jap...
1F0X_A       358 RPHFTDRAMQKFGHLFPSHLPPRMKNWRDKYEHHLLLKMAGDGVGEAKSWLVDYF--KQAEGDFFVCTPEEGSKAFLHRF 435
Q7V9S2       355 PENISDRLMQFIADILPNHLPIRLLSFRKKFNYYMLLLASNNSIEEMKLLLDIETe-KSEDFEYIECTESEGKDALLHRY 433 Prochlorococcus...
WP_014704174 355 PAKLSDHLMQYLSYLWPNHLPKKMDAFRERFAHHWILEMNDDGVEEARQYLSTFF--ASHEGDYFECTPAEGEKAILHRF 432 Methylophaga fr...
WP_012070441 356 PSKFSDIMMQYASQLFPNHLPKRMEDFREKYEHHWIVETSNDGVAEAQAYLDNFF--KDNEGDYFACTKREADQAILHRF 433 Marinomonas sp....
WP_013663082 356 PNKFSDRAMQFIADFFPNHLPQRMEEFRERFEHHWIVETANAGVDEAQAYLDEFF--KDNEGDYFACTEREADQAILHRF 433 Marinomonas med...
CAX57933     353 PANFVDKVLQFANNVTPKGVAPRILDYRERFEHHLMIKAEARHADELQRLLDTFF--SDRSGQYFACDAREERDAFLVRF 430 Erwinia billing...
WP_012804158 357 GPSVADAISQKLFSLVPEKIPARLAGFRDRYDHHLLVVVSGSEREGTARLLEEFFaaPEHEGAFFECDAEEAQSATLIRF 436 Brachybacterium...
Q8NRY8       359 GPTFADTVSQAMFSVLPNQLPKRMMEYRNRFEHHLLLTVSESQKAASEKMLKEFFaePEHTGEFFICTSDEEKSASLNRF 438 Corynebacterium...
Q0C1N1       343 RACLTDRLLQAVGRLAPPQLSETLRQMGEQYAHHLFLKVEADQAAGVRALLADVV--PALKGACHECSPAEGRQVFLHRF 420 Hyphomonas nept...
WP_013039750 357 SDAPSDRLLQRLGNLLPSPLSPPLRRYRDRYEHHLVIRVADDGIGEMRAYLEGVEr-DGDTTGWRECTDAEAERAFLLRF 435 Sphingobium jap...
1F0X_A       436 AAAGAAIRY-QAVHSDEVEDILALDIALRRNDTEWYEHLPPEIDSQLVHKLYYGHFMCYVFHQDYIVKKGVDVHALKEQM 514
Q7V9S2       434 VAGAAPARY-KILNPDLAGDLLPLDIAFPRNFKDWDQLLPQDILNEMSDSFEMAHFLCMVFHLDFVVKKGVDSKLLKEKI 512 Prochlorococcus...
WP_014704174 433 VAGGAVGRY-HTIKRKQFGPMMTVDVALKRNEQQWLEVLPQEIEDKLEAKLYLGHLFCHVMHQNYILKKGVDAKALKQQL 511 Methylophaga fr...
WP_012070441 434 VTGGALTRL-HIMNKKELGSIMTIDVAFPRNERDWFEELPQDIEDKVAVKMYYGHFFCHVMHQNYIMKKGVDAKAVKKQI 512 Marinomonas sp....
WP_013663082 434 VAGGAIGRY-HLMDGKDLGSIMTIDVAFPRNEREWFETLPKELEDQIAVKMYYGHFFCHVMHQNYIMKKGVDAKAVKNKI 512 Marinomonas med...
CAX57933     431 GVGGCTISYcDYKGINTDQRLIAFDVALRRNDTEWRIKLPQALQDQVLEDSCCGHFFCFVNHQDYILKPGVDALAFKHDV 510 Erwinia billing...
WP_012804158 437 GVASAASRF-FVMHRAEASAMVTFDVALRRDDEDWLERLPPHIAEQLLESVYFGHFFCHVLHQDHVAKKGVDPVALKQEM 515 Brachybacterium...
Q8NRY8       439 GAASAATRY-AALKRRHIAGLIPIDVALRRDDWNWLEVLPEEIDDQLEVKAYYGHFFCHVMHQDYVAKQGVDLEALHDRI 517 Corynebacterium...
Q0C1N1       421 AATGAAARH-AAMSRGKAGAVVELDVALRRNDKAWWYVLPDHLKGMVEHTLVHGHFFCHVFQQDYILKKGADAAAFRRGM 499 Hyphomonas nept...
WP_013039750 436 VAAGAAIRH-ASLEDGGVGRLVALDVALPRNCADWVEQLPDDISSQLVARATYAHFFCHVFHRDYLVRPGCDVEILKQRL 514 Sphingobium jap...
1F0X_A       515 LELLQQRGAQYPAEHNVGHLYKAPETLQKFYRENDPTNSMNPGIGKTSKRKNW 567
Q7V9S2       513 LKFLDSINAKYPAEHNVGHLYKAEKSLEVFYRELDPTNTFNSGIGKMSKRKNY 565 Prochlorococcus marinus
WP_014704174 512 LAFFDARGAEYPAEHNVGHEYHAKPALKTFYRKLDPTNGFNPGIGKTSKNKHW 564 Methylophaga frappieri
WP_012070441 513 LSSYDARGAEYPAEHNVGHEYVAKPALREFYQKTDPTNSFNSGIGGTSKLKNW 565 Marinomonas sp. MWYL1
WP_013663082 513 LESFDARGAEYPAEHNVGHEYIAKQALRDHYQKVDPTNAFNPGIGGTSKLKHW 565 Marinomonas mediterranea
CAX57933     511 LEYLDRRGAKYPAEHNVGHLYHASCEHESHMRQLDPTNSCNPGIGKTSKKKFW 563 Erwinia billingiae Eb661
WP_012804158 516 TALLESRGAAVPAEHNYGRLYPAPAPMVEHFQQLDPLNMFNAGVGETSPRRRW 568 Brachybacterium faecium
Q8NRY8       518 QHLLEERGAKLPAEHNYGRIYKLPESMEEHFKELDPTNTFNAGIGGTSPHKDW 570 Corynebacterium glutamicum ATCC 13032
Q0C1N1       500 AAHYEARGAECPAEHNVGHRHKAKPALAAFYRKLDPTNTLNPGIGRTSRDKNW 552 Hyphomonas neptunium ATCC 15444
WP_013039750 515 LDRLAEQGAEYPAEHNVGHHYVARPELASFYRTLDPCNSFNPGIGKTSRKAGW 567 Sphingobium japonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap