Conserved Protein Domain Family
Phytochelatin_C

?
pfam09328: Phytochelatin_C 
Domain of unknown function (DUF1984)
Members of this family of functionally uncharacterized domains are found at the C-terminus of plant phytochelatin synthases.
Statistics
?
PSSM-Id: 401316
View PSSM: pfam09328
Aligned: 9 rows
Threshold Bit Score: 413.753
Threshold Setting Gi: 947119172
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KRH67421     230 CRHEGWSSVAKFLTEDVPQLLKSEDLKDIQEVLSLAFKSPPSELRGLITWIAEVRRQEDGNLTLSEEEKGRLAIKADILE 309 soybean
XP_002320627 231 CRHKGWSSVANYLSADVPHLLKSEDVKDVEEVLSVVFKSPPADLREFIKWVAEVRRQDDGGIILSEEEKGRLSIKEEVLK 310 black cottonwood
Q8SAG8       231 CKHESWINIAKFLMDDVPLLLKSEDVKDILQVVSIIAASLPSNFEEFIKWIAEIRRREDGGPSLSAEEKARLAIKEEVLK 310 soybean
CBI37144     195 CKHESWVSTAKYLMDDVPVLLRSDDVKDVDKVLNVVFTSLPSKFGEFIKWVAEVRRQEDGGQNLSQEEKGRLAFKAEVLN 274 wine grape
XP_002320626 203 CKHESWVGVAKYLMDDVPLLLKSEDVKDINKVLHVVFLSLPSSFGDFIKWVAEIRRQEDGGQSLSQEEKGRLSVKDEVLK 282 black cottonwood
EEF32536     231 CKHESWASIAKYLVDDVPLLLKSEDVKDVNRLLYVVFTSLPSNFGEFIKWVAEVRRQEDGRGNLSQEEKGRLAVKEEVLK 310 castor bean
ERN18817     231 CKTEAWVTTAKYLIDEVPLLLKSEDSNSLQKAISVILSSMPADALEFIKWVAEVRSQEDNGSSLSEEEKERLRLKEEVLQ 310 Amborella trich...
XP_004968585 233 CRDENWKSMAKYCVEDLPNLLKGDNLDNVQTLLSRLIESLPAEAEALIKWVVEVRRKEEGDPSLSKEEKERLFLKENVLQ 312 foxtail millet
XP_009382679 231 CRDESWVSMAKYLIDDVPILLKSEDLKNVHEVLSLLLMSLPACAGNFIKWVAEVRRQEEEGSSLSKEEKDRLAVKEEVLQ 310 wild Malaysian ...
KRH67421     310 QIRTTGLFKHVTRWLDSESSCCNtLANLGDKDMLPALAASVCCQAADLLTvcgrlGLSGGKCC--SQIDVKHLNADSENP 387 soybean
XP_002320627 311 QVQGTELFKYVTRWLISEISTCK-GAISGHNNELPEIAANVCCQGAKLLTe----NFSSLDCMvfKKAGVKFWKSDGEKP 385 black cottonwood
Q8SAG8       311 QVQETGLFKHVASFLSSS---CSrQQVSGDGDTLPIIAASVCCQGAEILGgk---pSSAGYCC--RETCLKCLKAEDDKP 382 soybean
CBI37144     275 QVQEVGLFKHVTKYLSSANSCCTkPPFSGHKDNLPDIAASVCCQGAEFLAgk--yVSSNGFCC--RETCVKCFKTNGDKP 350 wine grape
XP_002320626 283 QVQETDLFKHVVAFLSSSNSCCRnVPILDQEDDLPDIAASVCCQGAEILAgk--sASVEGYFC--KEKCVKCLKANGDKP 358 black cottonwood
EEF32536     311 QVQEIGLFKHVAEFLSSANSCCKnMSILSQENYLPRVAASICCQGAEILAgr--sGTSGGYCC--SETCVRCLKTNDDKP 386 castor bean
ERN18817     311 QAHDTKLFEYVREWLSSASLC---HPWMREGKNISEIAANICCQGAGVLTst--iGLPKGTCC--RDTTIKSLEASG-KP 382 Amborella trich...
XP_004968585 313 QVRDTRLFAIVHDLQYANNPCCN-CSSSSEEDSLTRIAAAVCCQGAAMLSgn--lASRHGFCC--KETCLKCIQANGDGL 387 foxtail millet
XP_009382679 311 QVHETELYKCVTDLLSSSTSNCK----LRKKDSLTEIAANVCCEGAALLSgg--lTSRNGICC--R-TCIRCLKDNGDEH 381 wild Malaysian ...
KRH67421     388 VTLVSGIVTTgGGSEQGVDVLVPlCQREPSRLCLSNEGHCIGMHPSTADVLTVLLLALPLHTWSGIKEEKLRVEALSLLA 467 soybean
XP_002320627 386 VTVVSGTVFT-DGSEQGVDMLVPlSQTAASSLCDLDQNGCHGFHPSAGDVLSVLIFSLHQNTWSNIKDEKLQAEINSLVS 464 black cottonwood
Q8SAG8       383 ITMVSGTVVN-GNSEQGVDVLIP-SSSEKL-CCICSKSKYIRVHPASTDVLTVLLLSLPSTTWAGITDEQLLAEIHDLVS 459 soybean
CBI37144     351 ITVVSGTVVN-GNSEQGVDVLVP-SFPTKVGCCGSG-SNCTGMHPAGDDVLTALLLALPIDTWTGIKDEKLLQEMYRLVS 427 wine grape
XP_002320626 359 ITLISGTVVD-GISEQGLDVLVP-SSQTKMICCGCGPSSHIGMHPAGNDVLTALLLALPPVTWSGIKDEKLLQEIDALVS 436 black cottonwood
EEF32536     387 ITLVSGTVVD-GKTEQGLDVLVP-SSQMKP-SCGCGPSSHIGMYPAGNDVLTALLLALPPETWSGIKEEKLLQEIHALVS 463 castor bean
ERN18817     383 ITLVCGRVEW-WGGEQNVEMLVP-TCRERFDCSG----GCVEFHPSTSDVLTVLLLALPPQIWSGLRDKELLEELHGLLS 456 Amborella trich...
XP_004968585 388 KTVISASVVS-EGNEHGVDMLLPmSSPGAS-SCNSNLKNNVVKYPSSADVLTVLLLALHPSTWLGIKDEKLKAELQTLVS 465 foxtail millet
XP_009382679 382 TTVVSGTVVSgGGNEQEVDMLVPvSKATARSSCDTTLNNCIVMHPANNDVLTVLLLALPPSTWLDIQDESLLAEIQGLVS 461 wild Malaysian ...
KRH67421     468 TEDLPPLLQEEVLFLRDQL 486 soybean
XP_002320627 465 IDNVPPLLQEEVLHLRRQL 483 black cottonwood
Q8SAG8       460 IENLPTLLQEEVLHLRRQL 478 soybean
CBI37144     428 TENLPTLLQEEVLHLRGQL 446 wine grape
XP_002320626 437 TEHLPILLQEEVLHLRRQL 455 black cottonwood
EEF32536     464 SENLPTLLQEEVLHLRRQL 482 castor bean
ERN18817     457 PDNLPGLLQVEVMHLRRQF 475 Amborella trichopoda
XP_004968585 466 TDNLPDDLKREIMHLRRQL 484 foxtail millet
XP_009382679 462 TENLPDALQQEVLHLRWQL 480 wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap