6H7W


Conserved Protein Domain Family
Vps5

?
pfam09325: Vps5 
Vps5 C terminal like
Vps5 is a sorting nexin that functions in membrane trafficking. This is the C terminal dimerization domain.
Statistics
?
PSSM-Id: 401313
View PSSM: pfam09325
Aligned: 20 rows
Threshold Bit Score: 209.815
Threshold Setting Gi: 74861076
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6H7W_A    150 KFVEQDDWFHDRRVYLDALENQLKALLKAMDNMVAQRKAMAEAAADFSASLHALSTVELS--PTLSGPLDALSELQLAIR 227 
Q86IF6    309 SVKEIDGWFGDKKSYILQLDSTLHRLEDTINNVIRKRRELAAAMGELTSAGLSFSSCEIPvrQDIANGYQRLTEVENNIR 388  Dictyostelium dis...
Q7PVK3    177 KMDENDPWFNDKISEVETIDAHMQKLHSAIKALVSHRKELATLTGGVAKSAALLSTCEEH--TGLSQALSQLADVEEKVE 254  Anopheles gambiae...
Q9VQQ6    237 KMDENDPWFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEH--TGLSRALSNLADVEEKIE 314  fruit fly
O60749    298 KMNESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDH--TALSRALSQLAEVEEKID 375  human
Q13596    301 KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN--TALSRALSQLAEVEEKIE 378  human
CAP24541  248 HMEEGDRWFEQVQSQIDELDEALRKLYTVTESLVASRREMATSGELLGKALSMLAACEES--TSLSRALSALTDVTESVS 325  Caenorhabditis br...
Q5KI36    663 KFVEQDDWFNSRRAFLEALESQLKSLAKAIEISSKHRVEVAISLADYAESLTALAESDLG--ASLSAALSQMSGLVAREG 740  Cryptococcus neof...
KIS66287  843 SFEETDEWFNEQRVYLDSLESALKGMVKSVSALSNQRKQMVQATHDLAQVLTTLSGSSLS--RSLSTCFAGLAEVKRRAI 920  Ustilago maydis 521
Q9C0U7    358 KFSEQDPILIEAKDTLDSLETQLKSVYHALLLSIDQRIQFASAIHDFGEAVGNLSLVDLE--PTLSSKFDGLSQLQVELR 435  Schizosaccharomyc...
6H7W_A    228 DVYERQAQQDVLTFGIIIEEYIRLIGSVKQAFSQRQKAFHSWHSAESELMKKKAAQDKLLRQGKTQ-QDRLNQVNAEVID 306 
Q86IF6    389 QGMEDLSNNEQGYFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGA-------KAANMQKEVDD 461  Dictyostelium dis...
Q7PVK3    255 LLRSEQANSDLYILSETIKDYIGLFGAIKDVFHERVKVFQNWQHAQMQLTKKRENKAKLELQ--DR-RDKLEFAQKEVEE 331  Anopheles gambiae...
Q9VQQ6    315 LLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELA--NR-ADKLDQAQQEVDE 391  fruit fly
O60749    376 QLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVA--NK-PDKIQQAKNEIRE 452  human
Q13596    379 QLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWA--NK-PDKLQQAKDEILE 455  human
CAP24541  326 NAWGKQAEIDNAKFSEAIYEYIMLISALKDVFGERVRAWQQWQDAQQTLSRKRDQKTKIDLAAGGR-NEKSDQLKAEIEE 404  Caenorhabditis br...
Q5KI36    741 DYAEWHAKSEVGELLNLADEYIRFIGSVRSAFAARVDSWKVWQEKDKEVARMKTAREKARISGKLG--DRVQSSLKEIME 818  Cryptococcus neof...
KIS66287  921 ELEDMQAEADVRQLGTTMYEYERVVGSVRKAFTVRTEIWAKSARCADELRRTRARFEKYKQTNPSAaGAQFQSLLSELTE 1000 Ustilago maydis 521
Q9C0U7    436 FVQERKVAQDNLTLGTTLEEYIRYVESAKNAFTTRQKLWQTWQSSVQAVSRAKTQLEKCKKQAKSQ-QKSLPYLEEQYEK 514  Schizosaccharomyc...
6H7W_A    307 AERKVHQARLLFEDMGRLLRSELDRFEREKVEDFKSGVETFLESAVEAQKELIEKWETFLMQ 368 
Q86IF6    462 AVRKLTEATTEYEKISASARLELTKFDEKRAYEMKRILNYVIRLNLDHFLKSSDCWRELLTE 523  Dictyostelium discoideum
Q7PVK3    332 WEGKVQRCQKEFDNISSEIKKEMERFELARARDFKSTIIKYLEDQMAHQQQQMRYWEAIVPV 393  Anopheles gambiae str. PEST
Q9VQQ6    392 WQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAHQQQIVSYWEAFAPf 453  fruit fly
O60749    453 WEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPE 514  human
Q13596    456 WESRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPE 517  human
CAP24541  405 TVLRIDQLEQHFGELSKAIREEVARFDTDRKTDMKKILIDYMESMIHTHTEMLQLWEKFEPQ 466  Caenorhabditis briggsae
Q5KI36    819 AERRVHEASLEFDRLTKLVKSEFVRFERERVLEFKETLERYLNGLIEKEKEMIEGWEGLHSv 880  Cryptococcus neoformans
KIS66287 1001 AETKALNAERLFQTVSERCKDEMERLDLERVLDFKRVVGAWLEGMIQRQEEVVEEWVRYAGL 1062 Ustilago maydis 521
Q9C0U7    515 YRAKAADLEKEFSESTTLLKRDLSSLTTSRVDDLKASVETWLESAIESQKEIIERWESFLDQ 576  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap