Conserved Protein Domain Family
DUF1972

?
pfam09314: DUF1972 
Domain of unknown function (DUF1972)
Members of this family of functionally uncharacterized domains are found in bacterial glycosyltransferases and rhamnosyltransferases.
Statistics
?
PSSM-Id: 370426
View PSSM: pfam09314
Aligned: 6 rows
Threshold Bit Score: 322.84
Threshold Setting Gi: 145689029
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
bgi:05SSU0569   1 MRTVYIIGSKGIPAKYGGFETFVEKLTEYQKDK-SINYFVACTRENSAKSditgeVFEHNGATCFNIDVPNIGSAKAILY 79  Streptococcus ...
Q9A0G5          1 MQDVFIIGSRGLPAKYGGFETFVEELISHQSSK-NIRYHVACLSDTKHKV-----HFDYKGADCFYLNPPKLGPARVIAY 74  Streptococcus ...
Q5M3F3          7 MQHVFIIGSRGLPAKYGGFETFVEQLVSNQMSS-QVKYHVACLSDEKAYE-----HFEYKGVDCFTIKAPKLGPARVIAY 80  Streptococcus ...
Q8DYQ1          1 MQDVFIIGSRGLPARYGGFETFVSELINHQKSF-DIKYHVACLSDKEHHT-----HFNFADADCFTINPPQLGPARVIAY 74  Streptococcus ...
Q9CJ06          2 KKHVFIIGSRGLPAKYGGFETFVEELVKHQNNK-NIKYHVACQSENSDMAlp-geHFEYLGADCFVIKLPKIGSARVIAY 79  Lactococcus la...
Q8G7L9         11 VQHVFIVGSKGIPGNYGGYETFVDKLTEYHQNNpSLKYHVACKAKDTk-------TFEYHNADCFDVKVPDIGPAQAIYY 83  Bifidobacteriu...
bgi:05SSU0569  80 DIMALKKSIEIAKDRNDTSPIFYILACRIGPFIYLFKKQIESIGGQLFVNPDGHEWLREKWSYPVRQYWKFSESLMLKYA 159 Streptococcus ...
Q9A0G5         75 DMMAITYALSYSDQHQIQNPIFYVLGNTVGAFIAPFVKQIHNRGGRFFINPDGLEWKRSKWSRPVQAYLKFSEKQMTRQA 154 Streptococcus ...
Q5M3F3         81 DMMAINYALKKICEQNIKEPIFYVLGNTIGAFVAPFARKIHKLDGKFYINPDGLEWKRAKWPKPVQAYLKYSEKVMTRYA 160 Streptococcus ...
Q8DYQ1         75 DIMAINYALDLVKTHDLKEPIFYILGNTIGAFIWHFANKIHKVGGLLYVNPDGLEWKRSKWSRPTQRYLKYAEKCMTKNA 154 Streptococcus ...
Q9CJ06         80 DILAINVALKYCKKEEIKAPVFYILGNTAGGFIGHYANKIHKLGGKLFVNPDGLEWKRTKWAAPIRSYLKFAEKKMVRYA 159 Lactococcus la...
Q8G7L9         84 DVAALNYCVKYIKQHNIQHPIVYILACRIGPFAAHFQRVIHKLGGKLYINPDGHEWMRAKWSAPVRKYWKISEQLMTKHC 163 Bifidobacteriu...
bgi:05SSU0569 160 DLLICDSKNIEKYIHEDYRkyAPETSYIAYGTD 192 Streptococcus suis 05ZYH33
Q9A0G5        155 DLVISDNIGIDRYLKQVYP--WSKTCFIAYGTQ 185 Streptococcus pyogenes serotype M1
Q5M3F3        161 DLVISDNPGIETYIQDAYP--WSKTTYIAYGTD 191 Streptococcus thermophilus LMG 18311
Q8DYQ1        155 DLIISDNIGIENYIQSTYS--NVKTRFIAYGTE 185 Streptococcus agalactiae serogroup V
Q9CJ06        160 DLIISDNAGIKEYLTSEYG--QVESEVIAYGTE 190 Lactococcus lactis subsp. lactis
Q8G7L9        164 DLLICDSKNIEKYIHDEYGkyNPKTTFIAYGAE 196 Bifidobacterium longum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap