Conserved Protein Domain Family
PD-C2-AF1

?
pfam09310: PD-C2-AF1 
POU domain, class 2, associating factor 1
Members of this family are transcriptional coactivators that specifically associate with either OCT1 or OCT2, through recognition of their POU domains. They are essential for the response of B-cells to antigens and required for the formation of germinal centers.
Statistics
?
PSSM-Id: 401303
View PSSM: pfam09310
Aligned: 5 rows
Threshold Bit Score: 385.042
Threshold Setting Gi: 637356250
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008119288   7 SAPEPPPpqpSPRPYQGVRVKEPVKELLKRKRGSLqnANGATAAATTVFFPHQSLPSYSPAGQVCA----------DSEF 76  green anole
Q90ZH6         7 SASEQQP---QPRPYQGVRVKEPVKELLKRKRGNV--HNATAAAATTVVLPHQPLPSYSPMGQPCI----------DVDA 71  chicken
XP_001381387  31 SAPEQTPv--PPRPYQGVRVKEPVKELLRRKRGLA--SSGLTVAATTVVLPHQPLATYATMGPSCL----------DMEV 96  gray short-tail...
XP_546531      7 TAPEQAPa--PPRPYQGVRVKEPVKELLRRKRGHA--SSGAAVTPTAVVLPHQPLATYTTVGPSCL----------DMEV 72  dog
KAE8592590     8 NSEQQKNs--PARPYLGVRVKEPVKELLKRKRGNC--SNGNTMTPTVPSSYQ----TYPTCTP--IvsnltdlpyvDMDI 77  tropical clawed...
XP_008119288  77 VASPL--VDDGTLYSGWLAQPSPATLQPLTQWAAYPDYVPHEAVSCPYTGEMYVQPVCPSYTLVGTSSVLTYASQPLITN 154 green anole
Q90ZH6        72 AAPALpgAEEGALCSSWLSQPSPSSLQPLTQWTTYPDYVSHEAASCPYTADMYIQPMCPSYTLVGPSSVLTYASQPLITN 151 chicken
XP_001381387  97 PTSTV--TEEGALCTGWLSQPAPATLQPLTPWTPYPEYMPHEGVSCPYSTDMYVQPVCPSYTVVGPSSVLTYASQPLITN 174 gray short-tail...
XP_546531     73 SASTV--TEEGALCAGWLSQPGPATLQPLAPWTPYTEYVSHEAVSCPYSADMYVQPMCPSYTVVGPSSVLTYASQPLITN 150 dog
KAE8592590    78 PTTALplHDEGALYTGWISQPPSAAFQPLTQWTTCPEYISHETVSCPYTGDMYVQPMCQGYTVVGPPSVLTYTSQPLLTN 157 tropical clawed...
XP_008119288 155 LAARStSAPAVMPHLDMMEQQGPLSYFPWTQPISTLP--APSLQYQAASSALPAPQFLPLPVSVPETVSQDLEDTRKDLG 232 green anole
Q90ZH6       152 FTPRS-STPAVVPQLEVTEQQPPLTYFPWAQPLSALP--APTLQYQPASSTLPTPQFVPLPISIPEPAPQELEDARRVIG 228 chicken
XP_001381387 175 FTTRN-ATPTSGPQLEGTEHQAPLTYFSWPQPISALP--SSTLQYQSPAPSLPGPQFLPLPISIPEPVPQDLEDTRRAIN 251 gray short-tail...
XP_546531    151 VTTRSaAAPAVGPQLEGPEHQAPLTYFPWPQPLSTLP--TSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAIS 228 dog
KAE8592590   158 FAARS-ANPGVATQIEYTDHQGPLTYIPWAQPIATLPgaTHTIPYQTTSTTFQGTQFVPIPISLPEPVQQDLDDTRRVTN 236 tropical clawed...
XP_008119288 233 GLSMEKLLLQEENHGIFDLSNSLPVEG 259 green anole
Q90ZH6       229 TLPIEKLLLEDEDNDTYVLNHALSVEG 255 chicken
XP_001381387 252 TLPIEKLLLEEEESDTYGMNHTLSVEG 278 gray short-tailed opossum
XP_546531    229 SLTIDKLLLEEEDGDAYALNHTLSVEG 255 dog
KAE8592590   237 DLPMEKLLQENEDNESYALSHALSIEG 263 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap