Conserved Protein Domain Family
FCP1_C

?
pfam09309: FCP1_C 
FCP1, C-terminal
The C-terminal domain of FCP-1 is required for interaction with the carboxy terminal domain of RAP74. Interaction relies extensively on van der Waals contacts between hydrophobic residues situated within alpha-helices in both domains.
Statistics
?
PSSM-Id: 401302
View PSSM: pfam09309
Aligned: 19 rows
Threshold Bit Score: 314.795
Threshold Setting Gi: 542222417
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005450810  712 ERWERVEEQLYPLKEDYSKTARSNSPALLPDNQGSLQKPIFHPAPIHPRPpPAAPEVRTYDSVTGKLIRRGPQVSRPSAY 791  Nile tilapia
XP_007487884  791 ERWDKVEEQLFPLKEDYIKTQRENSPATFPDIQSAFPTALFHPTPIHPKC-QPGPEVRIYDSNTGKLIRKGSQNSGQSLY 869  gray short-ta...
XP_006011102  576 ERWERVEEKLFPLKEDYIKTQRANSPATFPDLPGAFQTPLFHPTPIHPKA-LSGPEVRIYDPNTGKLIRKGSQSSRQSPY 654  coelacanth
NP_001002873  676 ERWERVEEQLFPLKEDYNKSHRSNSPGAFLDIHGSAPRPPFQAPQVQPKP-LPAPEMRTYDPVTGKLIRRGPQASRPPSY 754  zebrafish
XP_014702417  588 ERWDKVEEQLFPLRDDYGRAQREESPAAFPDRQSALPAAVFHPTPVHPRA-QAGPEVRIYDANTGKLIRKGTAG------ 660  ass
XP_533365     692 ERWDRVEEQLFPLRDDYGRAQREDGPAAFPDRQGALPTALFHPTPVHPRT-QPGPEVRIYDANTGKLIRKGAVG------ 764  dog
XP_012820219  717 ERWEKVEEQLFPLKDDYMKSQRAISPTTFPDIQSAFQTPLFHPTPIHPKT-QPGPEVRLYDPVTGKLIRKGSQGSSQSPY 795  tropical claw...
CAG05997      691 ERWERVEEQLYPLKDDYSKKSRSNSPAAFHENLGSLQKRVFQSAAIRLKPaAPAPEIRTYDPVTGKLIRRAPQASAPPAF 770  spotted green...
XP_003219812  709 ERWDKVEEQLFPLKDDYLKTQRENSPAMFPDIHSAFQTALFHPTPIHPKC-QPSPEVRLYDPNTGKLIRKGSQNS----- 782  green anole
XP_028908388  589 ERWDKVEEQLFPLKEDYVKTQRENSPATFPDTQSAFQTALFHPTPIHPKC-QPGPEVRIYDPNTGKLIRKGSQNPGQSLY 667  platypus
XP_005450810  792 lHT-------SGS-MLLSDPREQSGLRGTSQSQQ-----DegVESGRD-DEQPGPSRRKRQPSMSETMPLYTLCKEDLDS 857  Nile tilapia
XP_007487884  870 iQS-------PASpVTLPVHGEHSSFRVVQPHQQqmfeeE--LPASQDeEEQPGPSRRKRQPSMSETMPLYTLCKEDLES 940  gray short-ta...
XP_006011102  655 iQP-------PGPpVKLAVHGEQSSFRVVQPQQQqqmldEeeM-TGQD-EEQPGPSRRKRQPSMSETMPLYTLCKEDLES 725  coelacanth
NP_001002873  755 lHS-------H-PsSSMSAKGDLSNLRSAQGSQQt----DepAGSSPD-DEQPGPSRRKRQPSMSETMPLYTLCKEDLDS 821  zebrafish
XP_014702417  661 ----------PGPpGSLPVHVEHSSFRVVQPHQQqmfgeE--LPDNQD-GEQPGPSRRKRQPSMSETMPLYTLCKEDLES 727  ass
XP_533365     765 ----------PGPpGSLAVHTEHSSFRVVQPP-RqmlaqE--LPDSRP-GEQPGPSGRKRQPSMSETMPLYTLCKEDLES 830  dog
XP_012820219  796 iQA-------PSPpLSLPVHGEHSSFRVVQPHQEqlfddDeeLPTANSdEEQSGPSRRKRQPSMSETMPLYTLCKEDLES 868  tropical claw...
CAG05997      771 -HA-------PGP-LSLSDQIEPSCLRGTSNCRP-----AetAGSSQD-DEQPGPSRRKRQLSMSETMPLYTLCKEDLES 835  spotted green...
XP_003219812  783 --SqsmyiqaPSPpLNLPVHGEHSLFRIVQPH-QqlfdeDg-MPSSEN--EEPGPSKRKRQPSMSETMPLYTLCKEDLES 856  green anole
XP_028908388  668 iQP-------PAPpLTLPVHGEHSSFRVVQPHQQqlfgeEe-LPANQD-GEQPGPSRRKRQPSMSETMPLYTLCKEDLES 738  platypus
XP_005450810  858 MDKEVDDILGEESDnESEGRgKEKPGNE--------------EMede-eeQQRq---rQQAGAGQTAERRlgpqALSiee 919  Nile tilapia
XP_007487884  941 MDKEVDDILGEGSD-DSDTE-KKKLEEG--------------EK------PQK-----GETENLGTQIEQ----RPGs-- 987  gray short-ta...
XP_006011102  726 MDKEVDDILGEDSDnDSDTE-KGKKVEE--------------EAkkk-qkQKN-----RHTENLGTKTVE----RLG--- 777  coelacanth
NP_001002873  822 MDKEVDDILGEESDnESEGKgKAGRIEE--------------EEe-----EVRphtskQKPPATDhi-----ppLAAvve 877  zebrafish
XP_014702417  728 MDKEVDDILGEGSD-DSDSE-KKKPEEQ--------------EEeeqegaPQP-----REPKAPGAHRGH----TLEp-- 780  ass
XP_533365     831 MDKEVDDILGEGSD-DSDNE-KRRPEEE--------------RKe----rPPP-----REPQATPEa------------- 872  dog
XP_012820219  869 MDKEVDDILGEGSD-DSDSE-KKKTI----------------KVk----kSQS-----AEQGNKLKNPEE----RTEs-- 915  tropical claw...
CAG05997      836 MDKEVDDILGEESDnESEGRgkdkpgneedeeqqqqqqqqqppppqqqpgPVEvkcrtSGPQALGLDERTp--------- 906  spotted green...
XP_003219812  857 MDKEVDDILGEGSD-DSDSE-KKKGRGR--------------KEk----aPQN-----NKKDPINIKTEE----RPVs-- 905  green anole
XP_028908388  739 MDKEVDDILGEGSD-ESDSE-KKKPEEE--------------EEe----eEKEkeeerKEEAEGKVAVS----------- 787  platypus
XP_005450810  920 -klqTPSNVASQCQSV-ARGQKRKHeqdKEE----------DDVDsnntedkeegekfvDESSKDSNEEEEGSNSEEDEM 987  Nile tilapia
XP_007487884  988 ----SSSSERSLSGSI-PRGHKRKL---NED----------DAAS--------------ESSKESSNEDEEGSSSEADEM 1035 gray short-ta...
XP_006011102  778 ----SSSSEGSLTGSV-PRGHKRKL----ED----------DSAS--------------ESSKESSNEDEEGSSSEADEM 824  coelacanth
NP_001002873  878 etsqTSTSEVCVTENV-LRGHKRKLeeaRED----------EDKDee-----------dGDSSKDSNEDEEGSSSEADEM 935  zebrafish
XP_014702417  781 ----TSSSERSAADGRgPRGHKRKL---NEG----------DAAS--------------ESSGESSCEDEEGSSSEADEM 829  ass
XP_533365     873 ----TPSSERTRAGSRgPRGHKRKL---PEE----------DAGS--------------ASSGESSGEDEEGSSSEADEM 921  dog
XP_012820219  916 ----SSSSERSLSGSR-PRGHKRKLe-eEEE----------DAES--------------ESSKESSNEDEEGSSSEADEM 965  tropical claw...
CAG05997      907 ----EPSSENNILGRV-PRGHKRKFdesDEEeeegraekevEDSS--------------DESFKDSNEEEGGSSSEADEM 967  spotted green...
XP_003219812  906 ----TSSSERSFTGSI-PRGHKRKL---VED----------DVAS--------------ESSKGSSNEDEEGSSSEADEM 953  green anole
XP_028908388  788 ----RRSGGRG-P-----KGHKRKR---PEA----------DVAS--------------ESSKESSNEDEEGSSSEADEM 830  platypus
XP_005450810  988 AAALEAELNDFM 999  Nile tilapia
XP_007487884 1036 AAALEAELNDFM 1047 gray short-tailed opossum
XP_006011102  825 AAALEAELNDFM 836  coelacanth
NP_001002873  936 AAALEAELNDFM 947  zebrafish
XP_014702417  830 AAALEAELSDLM 841  ass
XP_533365     922 AAALEAELNDLM 933  dog
XP_012820219  966 AAAIEAELNDFI 977  tropical clawed frog
CAG05997      968 AAALEAELNDFM 979  spotted green pufferfish
XP_003219812  954 AAALEAELNDFM 965  green anole
XP_028908388  831 AAALEAELNDFM 842  platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap