1XU1


Conserved Protein Domain Family
TACI-CRD2

?
pfam09305: TACI-CRD2 
Click on image for an interactive view with Cn3D
TACI, cysteine-rich domain
Members of this family are predominantly found in tumor necrosis factor receptor superfamily, member 13b (TACI), and are required for binding to the ligands APRIL and BAFF.
Statistics
?
PSSM-Id: 370419
View PSSM: pfam09305
Aligned: 13 rows
Threshold Bit Score: 64.7435
Threshold Setting Gi: 326928988
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XU1_R         2 LSCrKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENK 40  human
ELK15773      49 NYC-KEQGRYYDQLLRDCISCASICGHHPKQCTYFCENK 86  black flying fox
AAI41869      41 INCrKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKR 79  house mouse
XP_008250513  74 LSChKEPGRYYDPLLRDCVSCVSVCGQHPKPCAHFCDGR 112 rabbit
XP_003420728  69 LSChKEPGSYYDHLLNTCISCATICGQHPKQCAHFCENK 107 African savanna elephant
XP_012398336  39 LRCsKERGSYYDHLVKECISCYSICGQHPKQCAHICQTT 77  Tasmanian devil
XP_007655314  91 LKChRQQGVYYDTLLRQCIKCSATCGQHPLQCAPFCQNT 129 platypus
XP_008117574  44 MDCsKRVGFYYDKLLRDCIDCSGVCGQHPKECDPSCQRA 82  green anole
XP_005054445  49 MDCnKRPGFYYDELVKICIKCSLVCGQHPKECALSCERE 87  Collared flycatcher
XP_003210654  49 AVCnRRAGFYYDELVKKCINCSTLCGQHPKQCDAACGGS 87  turkey
XP_008505607  69 LSClKEQGRYYDQLLRDCVSCASICGRHPKQCTFFCENK 107 Przewalski's horse
XP_013220254  39 LSClKEQGKYYDRLLKDCVSCTPICGQHPKPCEYFCENK 77  thirteen-lined ground squirrel
XP_017920312  20 LSCrEEQGRYYDLLLRDCISCASICGRHPKQCTHYCEKT 58  goat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap