4IN3


Conserved Protein Domain Family
ChAPs

?
pfam09295: ChAPs 
Click on image for an interactive view with Cn3D
ChAPs (Chs5p-Arf1p-binding proteins)
ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialized cargo from the Golgi. They physically interact with Chs3, Chs5 and the small GTPase Arf1, and they form also interactions with each other.
Statistics
?
PSSM-Id: 401292
View PSSM: pfam09295
Aligned: 13 rows
Threshold Bit Score: 554.647
Threshold Setting Gi: 74604856
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4IN3_B    85 KGQIGTFFYCMGIDTSDPTSITIFAKKITDLFLDTPQIWFGKKKHFHVSKISISSWNAFRKYDVNIIVHIPGTVQTYIIN 164 baker's yeast
Q6FJM8    97 KGAIGTFFYTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDVNVIVHIPGAVQTYVLD 176 [Candida] glabrata
Q08754   123 KDEVGTFFYSMGVDTSGPTSIAIFLKEISEVISEKPQVWFGRKKTFNVARISFSTWNAFRRCDINVVVHIPGSIQNFIVD 202 Saccharomyces cerev...
Q6CIP6    51 KKTVGSFFYVAGLDTSDPASIAVWLKQLMECIQEKPQLWFGKNVKFTLEWISFTTWNIFKQCDMTIKMYLPGTFEIDFVD 130 Kluyveromyces lactis
Q752P5    73 KGAIGTYLYCAGADTSDPTSIAVFLKGIADSISEEPQVWFGKHKPYKVSKISYSTWNVFRQCDVNVTVHIPGTVQSYVLD 152 Eremothecium gossypii
Q59N76    52 ENEIGTFLYFTGVDTSNTASIAAHLQNIANLMTSKSQYWFGEKKHWKVPQLTYCTFNAFSKIDLRVTVHIPGKFEMQIIG 131 Candida albicans
Q6BIT3    52 NSEIGTFLYYTGVDTSNSASIAAHLQGLANLIGSRSQYWFGEKKHWKVPELTYCTYNAFSKVDMRVTVHIPGKFESSIIN 131 Debaryomyces hansenii
Q6CDA2    40 RGESGTYHYVIGVDVSSAASVAVHLNQLTYSL-GEEQLWFGKPQTWKITQGLLCSFNAFTKCDVRIIVKIPGGVESYFVD 118 Yarrowia lipolytica
Q7RY52    48 GKHYGVYHHVTGVDASSSASLAAYINTLTYKE-------FGNSATAKTVEGTYCCYNAFSRVDMRVHAPFPGSVESYCVD 120 Neurospora crassa
Q2UBV9    44 LSQTGVYHHVTGIDASSSASLAAYVNTLTFSP---------LDKTHKVVSGIYCCYNAFSHLDMRVEVKIPGSLESYCID 114 Aspergillus oryzae
Q5KDW8    51 QREIGSYHYCSGIEASSSASLAAYLNSLQFSV-EDSSAWFGKGSAWKVRSGTYCCFNAFSRVDMRVEANIPGGVDAFVVD 129 Cryptococcus neofor...
KIS67090  51 SRDIGSYHYVSGVDASSSAALAAYINSLTYEL-DQNPGFFSSKAAYKLKSGAYCCFNAFSRVDVRVEVRIPGSVDAYVVD 129 Ustilago maydis 521
P87317    51 SKEVGTYHFVSGVDASSSASLAAYLNTLSYSL-DKSQQWFGKGNAWRVSHGVYCCYNVFSQVDVRVEAKIPGGVDTYAID 129 Schizosaccharomyces...
4IN3_B   165 SDGEQ------SQLpsvaeass-grnsqdlnVNMIWAETFMSGIVRDIMIMKD----------------------NRADG 215 baker's yeast
Q6FJM8   177 SNGEHlpvsgnQTTptvastasanpidqaseMDVIWAETFISGVIRSIMFMKD----------------------NADDG 234 [Candida] glabrata
Q08754   203 CNGES------QNIemc------------adYDLIWAETFVSGVVRSIMLMKE----------------------NAEEG 242 Saccharomyces cerev...
Q6CIP6   131 KNRNKlqfdsdED------------------TDMAWAEAFISGKMRDIMCMVE----------------------NRDDG 170 Kluyveromyces lactis
Q752P5   153 VRGDVvh--ldEQE-----------------QEQLWAETFISGVTRTLMMMQD----------------------NFEDG 191 Eremothecium gossypii
Q59N76   132 QDGKLindnfnDEQ-----------------LDKLWSETFLTSIVRAVLESED----------------------GDDVN 172 Candida albicans
Q6BIT3   132 SDGKLihdkvsDNE-----------------SEKLWLETFVTSIVRCLIDSED-----------------------DDAN 171 Debaryomyces hansenii
Q6CDA2   119 PRGER------HSM-----------------TDQVWLETYMSAMIRSLLFADDdtflthgclklrplplkkknvvNGDSD 175 Yarrowia lipolytica
Q7RY52   121 ERGEK------RKA-----------------TDELWLETYLCSVLRAYSYADD-----------------------GSGE 154 Neurospora crassa
Q2UBV9   115 ERGDK------RVA-----------------TEALWLETFLCGVLRAYTYADD-----------------------GSGD 148 Aspergillus oryzae
Q5KDW8   130 LHGQR------HPA-----------------TPELWQETYLSAILRAIRYADD-----------------------AS-- 161 Cryptococcus neofor...
KIS67090 130 LRGER------HET-----------------TPEIWQEVYLSALLRSILYADD-----------------------AN-- 161 Ustilago maydis 521
P87317   130 ENGQK------HIV-----------------DARMWTEAYMSEVLRSLLYSDD-----------------------TN-- 161 Schizosaccharomyces...
4IN3_B   216 ESQNLVETLIFNPFTSGELEDV----ANNFIKLFPLVYEKGVYLDAPTHVLN--PSLTNNYLVETLVEIVRLTKSLEACR 289 baker's yeast
Q6FJM8   235 EAQPLVETLILNPLTAGKLDDV----ANTFIKLFPTVYERGVLTEAPCHVLV--PTRTNNYLVDTLVELVRLTKSVDICR 308 [Candida] glabrata
Q08754   243 ELQNLVETLILNPFTAGQIDDV----PEMFIDLFPIVYHKGPLLGAPYYITN--VTNTNNYLVETLVEIVKLTRNVSRAE 316 Saccharomyces cerev...
Q6CIP6   171 EVINVVETRIYNPLMTGQLDSV----DEMFFKLFPLFFPRGIEVGCPCIYGNmpSTLTNNYLVETLCEIVRFTKSIDLCL 246 Kluyveromyces lactis
Q752P5   192 EVNNIVETRILNPFTSSDIGDV----ATSFIKLFPTVYQQAPKLGAPPHIGA--VSHTNNYLVETLLHLTKLTANFDTCR 265 Eremothecium gossypii
Q59N76   173 KIGGLVEVRKINPFNNGITSKEl---LNNFLSAFELLFFEGVKLGCNVEIPQ--PTLINNYLVDGFIKVIQLTQSYDRGI 247 Candida albicans
Q6BIT3   172 KVGGLVEVRKLNPFNNGKSSKEl---LDYFMKGFEKLFWDGPKLGCGIDIPQ--PTIISNYLVDGFIKCVELTQNYEEAL 246 Debaryomyces hansenii
Q6CDA2   176 EGNSSKKDATSLPSLIPDSDNDvylgGDFFLDTFERLFGIGPLSGACSEIQV--PTLVSNYLVDAFMAFMRITRLYDRGL 253 Yarrowia lipolytica
Q7RY52   155 TIRKIMGVRRFNPVSSTETEHK-------FLSAAEQLFFRGWQLGSDSVVQV--PNNVSNHLTAGLLKYFSTTGRHTSGI 225 Neurospora crassa
Q2UBV9   149 SIRKIVGVRRFNPVTNTEMEHK-------FMDAAERLFFLGRQLSSDPETQV--PNTVSNHLTSGLLKYIRTTGRYTSGI 219 Aspergillus oryzae
Q5KDW8   162 --YRLAGYRKLDPITTPEAEER-------FLKAAEALFFKGWQLGSDPEIQV--ATVVTNHLTSAILKYFSDSFRLHRAA 230 Cryptococcus neofor...
KIS67090 162 --YRLAGYRKLDPISSPDAEHR-------FLQAAENLFFKGWQLGSDPEVQV--ATVVSNHLTAGILKYFGEASRYEQAV 230 Ustilago maydis 521
P87317   162 --SRFAGHRRFNPIPNPDAELR-------FFEAAEQLFTLGYTLGSSSEVRV--PTHVNNHLVRGIFAYLKQTCRYSAAL 230 Schizosaccharomyces...
4IN3_B   290 KMLKKLIEIH-PEAVIILIRVYFACDLEIDAVDLINEQLnspssflaDDSKTShiqlifkSELLSIQSEFLLDVKRDy-- 366 baker's yeast
Q6FJM8   309 PMLEELIKSY-PDASIVLARVLMACDYEIDAIDIINRELl------pHGEEDDtispifrAELLCLQTQFLMNVKNDy-- 379 [Candida] glabrata
Q08754   317 IMLKNLATDN-PEAIIILIKIFLVCDQELDAIKLTYDMLsqdkiinnTNNRMDy-----kSELLCLQAQFLIDKRQDy-- 388 Saccharomyces cerev...
Q6CIP6   247 PMLHELKEAFgPLVNIIIARIYLTNDKELDGIKLIHDTL---------QEIKDpt---yqCELLLLQAKYLLKHDDP--- 311 Kluyveromyces lactis
Q752P5   266 SVLEELRKEN-PEVVVILSRLLLLADLELDAVKLIHAEL--------SSNETTdy----tSELLCVETEFLLERKKDy-- 330 Eremothecium gossypii
Q59N76   248 EILQKLHEIE-PNVISLIAKLQLLKQDEIEAVKTMNHGI--------QENRRD-------SDLLVLQAEFCLEKKKP--- 308 Candida albicans
Q6BIT3   247 EILDRLKEKE-PGVVTLIARVLLLKDEEIRAVQVMNDGV--------ISDNRD-------ADLLLLQAQFCVDKKRY--- 307 Debaryomyces hansenii
Q6CDA2   254 EIVRRLQTEY-PEVVSLIARIQLLMDEEVEAVKTMVKGL--------EENGRD-------ADLLSLQAEFLLSKNRE--- 314 Yarrowia lipolytica
Q7RY52   226 NLFEKLRSQN-VEVASLLAKVLFMGNEEVQGVRVLYEAL--------KESPMD-------YVMLDTQAEFLLKKAETapt 289 Neurospora crassa
Q2UBV9   220 NLLEKLRIRD-VEVSSLLARVLIMADEEVQAVRLMYDSL--------QDVPMD-------YALLDCQAAFCQSKGES--- 280 Aspergillus oryzae
Q5KDW8   231 NLFERMMDKE-PEVAALVAKSYIGMNEEIKAVKIMNAAL--------AANPQS-------YPILHAQVDFLLSKHKY--- 291 Cryptococcus neofor...
KIS67090 231 NLFEKLWARE-PEVAALVAQSYIGMNEEIKAVQVMHSAI--------RETPQS-------YALLHAQVDFLRSKGKY--- 291 Ustilago maydis 521
P87317   231 NLFEKLRVSI-PEVSVLLAELYLLMDHEVHAVRILHDSL--------LKQRMS-------ASLLIVQVKFLISKERY--- 291 Schizosaccharomyces...
4IN3_B   367 --------KLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMS--QVKEKYVLRRIAPITSDEN---L 433 baker's yeast
Q6FJM8   380 --------KLALEVALSAVKFSPSEFIPWFLLTKIYIKLNDIENALLALNSCPMA--QSHERYVLKRAVPIGSEDN---L 446 [Candida] glabrata
Q08754   389 --------SLAQNIAQEAVNCSPSEFRPWYLLSKVYVKLNDIENALLILNSCPMS--PLKEKYVLKRVAPLPSNNS---L 455 Saccharomyces cerev...
Q6CIP6   312 --------LLALEASQRGVDLTPNAFMPWFYLVKSYIALGDNKNALLSLNSLPMNlaSLAQKYQYRRILNTDGNNAtveL 383 Kluyveromyces lactis
Q752P5   331 --------ELACATAQAAVHSAPSEFKPWYLLVKSFTALGDIENALLTLNTCPMS--PLKEKYVFRRIVPVTQESGn--L 398 Eremothecium gossypii
Q59N76   309 --------ELALELAKQAVKSSPSDFKTWAILVQIYTKLGDFENALLTLNSCPMN--SHKEKYFLKRVVPIKSNDD---L 375 Candida albicans
Q6BIT3   308 --------DLALNISKQAVKSSPSDFKTWAMLVKVYTKLNDFENALLTLNSCPMN--SHKEKYYLKRIVPLKGGNDd--L 375 Debaryomyces hansenii
Q6CDA2   315 --------DMALGCATRAVNSAPSESKLWTELVQVYIRQKDWENALLTLNSCPMF--TYHEHDQHRMPAPAK-------S 377 Yarrowia lipolytica
Q7RY52   290 pelreerlRMALGCADRSTIAAPSEFGTWARLAQVYVAMEDWENALTILNSCPMF--TYQDKDAPVMPEPKD-------V 360 Neurospora crassa
Q2UBV9   281 --------EMALECAKRAVTAAPSEFSTWARLAEVYVNSEQWDLALLTLNSCPMF--TYQDKDTPRMPQPSR-------I 343 Aspergillus oryzae
Q5KDW8   292 --------EWAQQVAQQAVNSAPSEFTTWAKLTETYIELGQLDQALLTLNSCPMF--TYNERDLHRMPTPAK-------S 354 Cryptococcus neofor...
KIS67090 292 --------EWALKVAKQAVNCAPSEFVTWAKLTECYIDLEQWESALYTLNSCPMF--TYNERDLHRMPTPAR-------S 354 Ustilago maydis 521
P87317   292 --------DLALICAKRAVHASPSEFATWACLADVYLHLEDFKSALLALNSCPMY--TYYERDAYPLPPSAR-------A 354 Schizosaccharomyces...
4IN3_B   434 HLPLPLDASIEEISSLNPMD--VQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVMEDEYQ 511 baker's yeast
Q6FJM8   447 HLPLPENIGVDEILQLNPSD--VNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWETLLKCRSKIFVMEDEYQ 524 [Candida] glabrata
Q08754   456 HLPLPIDVVLDEVTSLNPQD--VQNEHRSADPMLVNLAASNLKSTFQLAYRLLTEIVQITGWENLLKYRSNIFVMEEEYQ 533 Saccharomyces cerev...
Q6CIP6   384 HLPLPLDVVLDEVTNLNSLL--VMEEHKIVNPVLYNLKSANLKNTFQWIYELLCEIVKSLGWEKLLQLRAELFLMEEEYD 461 Kluyveromyces lactis
Q752P5   399 HIPLPVDVILEEVTGLDSHE--VITEHKSVDPSLLNLPAANLKSNFQLAYSLLAEIAKKTGWEPLLKYRAKLFVMEEEYR 476 Eremothecium gossypii
Q59N76   376 HLPSPTDVTLDQVSNLQSNE--ISYEQRNLDPSLVNLPAGNLKSTFAKAYDLLTEIVVKTGWESLLKYRAKVFVMEEEYR 453 Candida albicans
Q6BIT3   376 HLPSPVDVTLDEVSNLQSNE--ISYEQRNLDPQLINLPAANLKSTFAKAYDLLTEIVNKTGWEALLKYRAKVFVMEEEYR 453 Debaryomyces hansenii
Q6CDA2   378 HYPLPLDGILKDVYEASQVD--QTEEHAQIDPKLLKLPAPNLRATFAKVYEHLTAIVHEIGWDQLLEVRSRVFVMDEEYK 455 Yarrowia lipolytica
Q7RY52   361 NLPTLPETRLDEIDSEPDSR-----FSEQVDPSLLGLRAAAYRGTFKQAYSILTEMTAKIGWDQLLKIRSNVFVMEDEYR 435 Neurospora crassa
Q2UBV9   344 MLPILAESMLDEIDEGQPKQ---GDPHDYVHPSLRRLHASAYQGTFLKAYNLLTKIAAAIGWDQLLKIRSEVFVMEEEYR 420 Aspergillus oryzae
Q5KDW8   355 NMPVKKFIADSNLVDEDSSR------ENEADIALLRLPAPNLRGTFAKAYSLLTLLVSKIGWDELLKIRSSVFVMEEEYR 428 Cryptococcus neofor...
KIS67090 355 HLPIKTFIAESGLVDEESAR------DNEADVALLRLPAPALRGTFAKAYALLGRLVNSIGWDELLRYRSNVFVMEEEYR 428 Ustilago maydis 521
P87317   355 HLPFPVNFPKEELEVENNAQngYTVSTEITDPYLARLPSPSLRGTFAKAYEMLTLICAKIGWDELLRVRSAVFVMEEEYR 434 Schizosaccharomyces...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap