4NRV


Conserved Protein Domain Family
Neil1-DNA_bind

?
pfam09292: Neil1-DNA_bind 
Endonuclease VIII-like 1, DNA bind
Members of this family are predominantly found in Endonuclease VIII-like 1 and adopt a glucocorticoid receptor-like fold. They allow for DNA binding.
Statistics
?
PSSM-Id: 401289
View PSSM: pfam09292
Aligned: 13 rows
Threshold Bit Score: 83.9972
Threshold Setting Gi: 156216845
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4NRV_A       251 DFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAP 289
EFX74223     253 DHGAFENWLQCYQNPSMNNLQDRHKRRIWFEGEPGILVP 291 common water flea
EDO37773     250 GYSRFQEWLQCYYNTDLNNLVDHDGRTMWFKGKPGPLAP 288 starlet sea anemone
XP_004069676 262 DYSAFQAWLQCYYVDGMKSIRDHNGRTMWFKGDPGPMAP 300 Japanese medaka
Q6TGW9       269 EYSVLQAWMRCYSVDGMNSLNDHNGRTIWFKGDPGPLVP 307 zebrafish
XP_013001066 261 DFAAFRAWLQCYNVPGMSSLRDHNGRTIWFQGDPGPLAP 299 domestic guinea pig
XP_014998237 252 DFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAP 290 Rhesus monkey
XP_012396272 252 DFSAFRAWLRCYSVSGMSCLPDRHGRTIWFQGDPGPLAP 290 Tasmanian devil
NP_001116270 247 NYSEFEKWLRCYFVPGMKSLRDSNGRTIWFQGDPGPLAP 285 tropical clawed frog
XP_005994967 251 DYSPFEGWLQCYSVPGMKTLRDGNGRTMWFQGEAGPMAP 289 coelacanth
EKC29161     247 NFAIFIGWLQCYNKPEMKNMGDHNKRTVFYCGDPGPMVP 285 Pacific oyster
KFP67287     112 NYAAFKNWLQCYLVPGMSSLRDRNGRTIWFQGEPGPMAP 150 Red-legged seriema
XP_030832550 283 DYSDFMKWLQCYSKDGMKNMVDHNDRTIWFSGPPGPMVP 321 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap