1TTE


Conserved Protein Domain Family
UBA_3

?
pfam09288: UBA_3 
Click on image for an interactive view with Cn3D
Fungal ubiquitin-associated domain
Members of this family of ubiquitin binding domains adopt a structure consisting of a three alpha-helix bundle. They are predominantly found in fungal ubiquitin-protein ligases.
Statistics
?
PSSM-Id: 117832
View PSSM: pfam09288
Aligned: 6 rows
Threshold Bit Score: 85.6165
Threshold Setting Gi: 74659734
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TTE_A   161 EESDLYGIDHDLIDEFESQGFEKDKIVEVLRRLGVKSLDPNDNNTANRIIEELLK 215 baker's yeast
Q759V3   157 EEAQLYGIDKGLVDTLVAQGFEREKVVQALRRLGIKTMDKGDNEKANIILEELLK 211 Eremothecium gossypii
Q6FVM7   159 DEAQLYGIDPEIVKEFESQGFEKNKIVEALRRLGVKSLDPNDNATVNKIIEELLK 213 [Candida] glabrata
Q6CSQ8   173 DEADLYGIDQDLVTQFVNQGFDRQNVIEVLKRLNIKSMSMEDNETANKILEELLK 227 Kluyveromyces lactis
Q6C353   158 DEIARLGLDRDAVEGFASMGFGKDKIIAVFKKLQIKK--PQSQEDEQRVVEELLN 210 Yarrowia lipolytica
KIS72103 174 DPILLAGLKREHVDQFVNMGFETNKVIEALKKLNYRGAN-VRNITDDTVLNELLK 227 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap