1OQY,2F4M


Conserved Protein Domain Family
XPC-binding

?
pfam09280: XPC-binding 
XPC-binding domain
Members of this family adopt a structure consisting of four alpha helices, arranged in an array. They bind specifically and directly to the xeroderma pigmentosum group C protein (XPC) to initiate nucleotide excision repair.
Statistics
?
PSSM-Id: 401280
View PSSM: pfam09280
Aligned: 93 rows
Threshold Bit Score: 43.2479
Threshold Setting Gi: 122125999
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OQY_A               237 LEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPP 293 
CAQ39527             257 pdQFRSSPFFNILRDVALSNPQRIPEILEMIGRTDPSFLEFIRENQGEFIRAIQNYG 313  Plasmodium knowlesi strain H
Q38B86               180 prSLQDHQTMVSIVEYVDRDPTRLRDVLRTILEEEPDLFRWIEANSEVFLAIINGPV 236  Trypanosoma brucei
CBJ25906             178 LEDFRGHPQFNELKRLVQRDPTQLSSILQMIGRQSPNLLARIHENQGDFIALMNEPI 234  Ectocarpus siliculosus
Q17JC6               219 LAFLREHPTFLEMKRLLQEDPSLLPHLLQKIQSSNPDLMRIISENQVEFLSLINEGT 275  yellow fever mosquito
ETN66238             268 LAFLRGNPVFFEMKRLLQEDPSLLPYLMQRIQYSNPNLMRIISENQEEFLAMINENS 324  Anopheles darlingi
WGS:AANI:GJ14198-PA  179 LNYLATDPRFAHVRDLIRQNPELLELVLTHLRESDPAAFEAIRSNQEEFISMLNEPT 235  Drosophila virilis
XP_001964524         189 lQPWMSDPRFARVRDMLRQNPELLEVVLSRLAETDPSAFEAIRDHQDEFLSMINGSS 245  Drosophila ananassae
EDX14159             172 LQHLLADPSITRMREMLNQNPELMHRLMDRLAETDPATFEALGSNQD-FLNMISGGA 227  Drosophila simulans
Q9VCD5               172 LQQLMADLNITRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEELMNMISGGA 228  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap