5GPE,1Q08,4WLS


Conserved Protein Domain Family
MerR-DNA-bind

?
pfam09278: MerR-DNA-bind 
Click on image for an interactive view with Cn3D
MerR, DNA binding
Members of this family of DNA-binding domains are predominantly found in the prokaryotic transcriptional regulator MerR. They adopt a structure consisting of a core of three alpha helices, with an architecture that is similar to that of the 'winged helix' fold.
Statistics
?
PSSM-Id: 401278
View PSSM: pfam09278
Aligned: 225 rows
Threshold Bit Score: 32.0992
Threshold Setting Gi: 81713170
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5GPE_E  45 LQRLLFIRRCRAKDMTLDEIRQLLNLRDR-PELGCGEVNALVDAHIAQVRTKMKELRALERELMDL 109 Cupriavidus metallidurans CH34
P0A4T8  46 LDRLQQILFYRELGFPLDEVAALL-------DDPAADPRAHLRRQHELLSARIGKLQKMAAAVEQA 104 Streptomyces coelicolor A3(2)
Q24PL3  46 VDRLQQILFYRELGMSLEGIKDMVTSPDFdGAKALREHREKLLEKREQLEQLIANVEKTIAQKEGR 111 Desulfitobacterium hafniense Y51
Q8DQI9  18 LERLQVILYYKYLGFSLEKIAELL------KEERTDLLP-HLTRQLDYLTRERQHLDTLISTLQKT 76  Streptococcus pneumoniae R6
Q38UG1  45 ADRLQLILMYRQLQFSLAEIQQLL------ALSPAERLT-HLAAKRDELTKQQAVLTATLAQLDAT 103 Lactobacillus sakei subsp. sakei 23K
Q67MC4  49 VRRLLSIISLKRLGFSLREIKVLL-------SDAAEDPRAMLQVQLARLDEQIAALTEVRAHVQRL 107 Symbiobacterium thermophilum
Q47PS2  78 LSYVQGALLLKELGFSLEEVRELCQGTQErTGEASARTHAMLATKMAVLEQRIRLLSRLHDLIRAA 143 Thermobifida fusca YX
Q5Z1R1  46 VERVGVILIGKSVGFSLDEIRELFAQ----VADRSGRRR-LLQAQHDRLTEHIARAEAARAAIEHA 106 Nocardia farcinica
Q5YV47  46 FARLDVIALCKAAGFTLEEIRLLL--RDD--APGRPDSRALAHAKLAAIDRQLDTLARARAIVEWG 107 Nocardia farcinica
Q47RZ5  50 VGLVALILRGKDAGFSLEQMRDLL------VAPDGETRRALLTDHLAALDAKIAQLQRARALVEHT 109 Thermobifida fusca YX
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap