5E24,1TTU


Conserved Protein Domain Family
BTD

?
pfam09270: BTD 
Beta-trefoil DNA-binding domain
Members of this family of DNA binding domains adopt a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and co-repressors (SMRT/N-Cor and CIR).
Statistics
?
PSSM-Id: 401273
View PSSM: pfam09270
Aligned: 19 rows
Threshold Bit Score: 162.098
Threshold Setting Gi: 74644190
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5E24_E       182 EGGHFHASSTQWGAFTIH-LLDDNESESEEFQVRDGYIHYGATVKLVCSVTGMALPRLIIRKVDKQMALLEADDPVSQLH 260
XP_002609703 176 ESGNFHASSQEWGAFTIH-LLEESQSESEHFTVRDGYIHYGSCVKLVCCVTGMALPRLVIRKVDKQMAHLTADDPVSQLH 254 Florida lancelet
ELW61422     206 EGGNFHASSQQWGAFYIH-LLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLH 284 Chinese tree shrew
XP_001600894 194 NGDQFHASSTQWSTFTIY-LLDDDESENEDFEAKDGYIHYNSTVKLVCKDTGMALPRLIIRKVDKSMASLDADDPVSQLH 272 jewel wasp
KFQ02554     127 EGGAFIASARQWAAFTLH-L-ADEHCTRSEFPLREGYIRYGSVVQLVCTATGITLPPLIIRKVTKQYAMLDVDEPISQLH 204 white-tailed eagle
XP_006639825 318 EGGAFVASARQWAAFTIT-LGGEQQAEQGQYPPREGYICYGCSVRLVCTGTGVALPPMVIRKVNKQHAMLDVNEPVSQLH 396 spotted gar
XP_013130969 255 DRGAFIASARHWTAFTIT-MVDDQCADQGGFVLSEGFICYGCVVQLVCTESGAALPPMVIRKVNKQHAILDVDEPVSQLH 333 Nile tilapia
XP_015786929 209 ENKHFHASSTQWSAFTIH-LLDDNEAESEEFTVQDGFIHYGSTVKLVDAITGVALPRLIIRKVDKQEALLDADDPVSQLH 287 two-spotted spi...
CAF93580     175 DRGAFIVSARQWTAFTITaL-SDHHSGHRD-VLSEGFICDGCVVQLVCTESGVALPPMVIRKVNKQHAILDVDEPVSQLH 252 spotted green p...
XP_022541043 178 EGGAFVASARQWTAFTVI-LveeqqADHGDYSVCDSYICYGCVVQLVCTNSGVALPPMVIRKVNKQHVCLDVDEPVSQLH 256 Mexican tetra
5E24_E       261 KCAFYMKDTDRMYLCLSQEKIIQF---------------------QATPCPKEPNKEMINDGACW 304
XP_002609703 255 KCCFHLKDSDRMYLCVSQERIIQF---------------------QAAECPKDPTKEILNDGAAW 298 Florida lancelet
ELW61422     285 KCAFYLKDTERMYLCLSQERIIQF---------------------QATPCPKEPNKEMINDGASW 328 Chinese tree shrew
XP_001600894 273 KCALFLKDTDHMYLCLSQEKIVPF---------------------NATPSPKEANKHMINDGACW 316 jewel wasp
KFQ02554     205 KCAFQFQGSDRMYLCLSTEKVIQF---------------------QASPCPKEANRELLNDGSCW 248 white-tailed eagle
XP_006639825 397 KCAFQFKDSSRMYLCLSNEKIIQF---------------------QASPCSKDPSKELLNDGSCW 440 spotted gar
XP_013130969 334 KCAFQFRDNPHAYLCLTNDAIIQY---------------------QAPFSVRDPSKVVLNDGSCW 377 Nile tilapia
XP_015786929 288 KCAFYLKDTERMYLCLNQDKIIQF---------------------QATACNNGQNKEVLTDGASW 331 two-spotted spider mite
CAF93580     253 KCAFQFRDGPHAFLCLSNDSVVRHqvrtrplhlgppgppltpgvlQASCSPREPSRVVLNEGSCW 317 spotted green pufferfish
XP_022541043 257 KCAFQFRDSKHMYLCLSNEKILQY---------------------QASPCPKESSRELLNDvhvp 300 Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap