2EXR,3S1E


Conserved Protein Domain Family
Cytokin-bind

?
pfam09265: Cytokin-bind 
Click on image for an interactive view with Cn3D
Cytokinin dehydrogenase 1, FAD and cytokinin binding
Members of this family adopt an alpha+beta sandwich structure with an antiparallel beta-sheet, in a ferredoxin-like fold. They are predominantly found in plant cytokinin dehydrogenase 1, where they are capable of binding both FAD and cytokinin substrates. The substrate displays a 'plug-into-socket' binding mode that seals the catalytic site and precisely positions the carbon atom undergoing oxidation in close contact with the reactive locus of the flavin.
Statistics
?
PSSM-Id: 401270
View PSSM: pfam09265
Aligned: 70 rows
Threshold Bit Score: 332.195
Threshold Setting Gi: 1091711174
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EXR_A       239 PDXVRWIRVVYTEFDEFTQDAEWLVSQk--nESSFDYVEGFVFV-NgaDPVNGWPTVpLHPDH-EFDPTRlpQSC----- 309 thale cress
XP_018682012 230 PPMVAWIRVKHHDFDQFTRHGELVVNS-----GEVDYLEGFIKFgDa--------PQsHQPKNa--FSRFgaERCvkprq 294 wild Malaysian ...
XP_006847935 225 PHKVKWVRAFYDDFGAFTEDQEMLVSM----ADKVDYVEGFMVL-Ne-QSLEG--ASvAFPSHfHFIASNtnNT------ 290 Amborella trich...
XP_009412415 232 PPKVKWVRAFYDDFETFTEDQELLVAM----PDAVDYVEGFILL-Ne-QSLHS--SSvAFPSHlEFTPEFdsNGSn---- 299 wild Malaysian ...
XP_002446804 234 PPKVRWVRAFYDSFETFTKDQELLVSM----PELVDYVEGFMVL-Ne-QSLHS--SSvAFPAPvNFTPDFgsDAGssssn 305 sorghum
A3AVP1       239 PPKVRWVRAFYDSFETFTGDQELLVSM----PEQVDYVEGFMVL-Ne-QSLHS--SSvAFPAQlNFSPDFgsKGR----- 305 Japanese rice
Q8LNV6       232 PQKVKWVRAFYDDFATFTKDQELLVSM----PVLVDYVEGFIVL-Ne-QSLHS--SSiAFPTNvDFNPDFgtKNN----- 298 Japanese rice
XP_009390682 234 PEKVKWVRAFYDDFDTFTSDQELLISM----PELVDYVEGFVVL-Ne-QFLHG--SStAFPTHlDFTPEFhsNGS----- 300 wild Malaysian ...
XP_009408161 235 PQKVRWARAFYDDFDTFTRDQELLLSM----PDLVDYLEGFIVP-Nq-LSLLG--TSiAFPAHlGFVPEF---------- 296 wild Malaysian ...
EFJ10917     247 PQKVKWIRALYSDFKAFTRDQELLIARpkdsPNSFDYVEGSVIV-NnnHPSNEYKPIpFHGQTlN--ASLipPSA----- 318 Selaginella moe...
2EXR_A       310 GSVLYCLELGLHYrDSDS--NSTIDKRVERLIGRLRFNEGLRFEVDLPYVDFLLRVKRSEEIAKENGTWETPHPWLNLFV 387 thale cress
XP_018682012 295 PTAYYLLEMAIYY---DDddVSDAAKKRAKVLARVSSMTSVEI-LEVSYLDFLNRVREEELSLRRMGLWDVPHPWMNLFV 370 wild Malaysian ...
XP_006847935 291 SQVYYCVEIAFYYySQKAs---HVEKVAKETLRKLDCIPSLVYETEVSYFDFLNRVSAEEANLRARGLWEVAHPWLNMFV 367 Amborella trich...
XP_009412415 300 YRVYHCIEFAIHDyQVESt---DVEQVVTEISRKMSHIPSHFYSVEVSYFDFLNRVRMEEVSLRSRGLWEVAHPWLNLFV 376 wild Malaysian ...
XP_002446804 306 KVVYYCIEYAVHDfQQQDsaAATADHVVDLVSGKLSYLRPHAYSVEVAYWDFLNRVRVEEESLRSRGLWDVPHPWLNLFV 385 sorghum
A3AVP1       306 KKVYYCIEFAVHDfQQDSs---RADHVVKLVSAKLSYLRPHVYSVEVSYFDFLNRVRMEEESLRSRGLWDVPHPWLNVFV 382 Japanese rice
Q8LNV6       299 PKIYYCIEFAVHDyQNKNi---NVEQVVEVISRQMSHIASHLYSVEVSYFDFLNRVRMEEMSLRNSGLWEVHHPWLNMFV 375 Japanese rice
XP_009390682 301 SNVYYCIEFAVHDdGSKNa---STEEVVEEIARRMSHLPSHLYGAEVSYYDFLNRVRMEEMSLRSVGLWEVPHPWLNMFV 377 wild Malaysian ...
XP_009408161 297 HKVYYCIEFAVHDfQAKGt---NAEQVVEKITKQMSHIPSLMYSVEVSYFDFLNRVRIEEMSLRSRGLWEVPHPWLNMFV 373 wild Malaysian ...
EFJ10917     319 GPVLYCLELTKNY-DEDE--SATIDETVSSLLAPLGHVPSLVFSKDASYFEFLNRVHDGEIRLRKKGLWDVPHPWMNLLV 395 Selaginella moe...
2EXR_A       388 SKRDIGDFNRTVFKELVKnGvNGPXLVYPLLRSRWDDRTSVVIPeE--------GEIFYIVALLRFVPPca--kVSSVEK 457 thale cress
XP_018682012 371 PRSQIRRFHDLFLRTMsdsCvNGPIIMYPTLRHQWNLNTSIVVP-Qde----agEDVFYVVSVLRAAPPictvgSSCLDG 445 wild Malaysian ...
XP_006847935 368 PRSQIKAFKDLLLQTIspdHfEGPILIYPIRRDKWNGNTSAVLP-Ed------kENILYIVGMLRSASPqcvseSPCLQS 440 Amborella trich...
XP_009412415 377 PKSGIREFKDLLLDNIsptDfEGLVLIYPLLRDKWDANSSAVLP-Dggg--raeEQVMYIVGVLRSANPat-caAQCLRD 452 wild Malaysian ...
XP_002446804 386 PSHGAARFKDMLMDTVtqgDfEGPVLVYPLLTDRWDGNMSAVVP-As------pDGVVYVFSVLRSTDPar-cgGACVEG 457 sorghum
A3AVP1       383 PKHGITQFKGLLMDTVsadDfEGPILVYPLLTDKWDGNTSAVVP-Aa------pDGVMYIFGVLRSTDPar-cgRACVDS 454 Japanese rice
Q8LNV6       376 PSAGISDFRDLLMDSIspdNfEGLILIYPLLRHKWDTNTSVVLP-Dsg----stDQVMYAVGILRSANPddgcsHHCLQE 450 Japanese rice
XP_009390682 378 PKSGIKAFRDLLLETIspdEfAGPILLYPLLRDKWDTNTSVVLP-DaaggaaedERVLYIVGVLRSANPas-ctAECLRD 455 wild Malaysian ...
XP_009408161 374 PRSGIKDFKDLLLENIspeEfEGPILVYPLLRDKWDANTSAVLP-Dap-----aEQVVYIVGVLRSATPas-cpARCLDD 446 wild Malaysian ...
EFJ10917     396 PKSKIEEFDALVFREILRkGiNGPLLVYPLDKMKWDSRTSVVMP-D--------ENIFYLVGMLRYATPs---gVPSVNS 463 Selaginella moe...
2EXR_A       458 XVAQNQEIVHWCV-------------------------KN-------GIDYKLYLPHYKSQEEWIRHFG-NRWSRFVDRK 504 thale cress
XP_018682012 446 LMQQNEQMIRMAT-------------------------ARgsshgggGMGAKQYMPYLRCEEEWREHFG-QKWKRFEELK 499 wild Malaysian ...
XP_006847935 441 YLQQNNKITEGATsislhsnskiqiadpngqdheletiSGsdslkrsDLGGKLYLSYYSEEEHWKKHFG-GKWERFLARK 519 Amborella trich...
XP_009412415 453 LLRRRRRVAKVAT-------------------------DP-------RIGAKQYLARHPSQGQWQDHFG-RHWDRFVARK 499 wild Malaysian ...
XP_002446804 458 ILEQHRRVADEAC-------------------------R--------RLGAKQYLARQPSRAHWRDHFGpAAWDRFVARK 504 sorghum
A3AVP1       455 IMARHRRVADEAC-------------------------RDggg-ggrGIGAKQYLARQPSPARWRDHFG-AGWGRFAARK 507 Japanese rice
Q8LNV6       451 LLLRHRRLAGAAA-------------------------S--------GLGAKQYLAHHPTPAGWRRHFG-RRWERFADRK 496 Japanese rice
XP_009390682 456 LLRLNRGIADAAS-------------------------AP-------GIGAKQYIPHHPSPSHWREHFG-RRWERLAARK 502 wild Malaysian ...
XP_009408161 447 ILRRNRRIVEAAS-------------------------AP-------RIGAKQYLPRHPSPLHWPDHFG-RRWNRFTARK 493 wild Malaysian ...
EFJ10917     464 LVDQNKEILRVCK-------------------------SA-------GIHLKQYIPQLSSEEEWREHYG-SSWSLFLRRK 510 Selaginella moe...
2EXR_A       505 AXFDPXAILSPGQKIF 520 thale cress
XP_018682012 500 SKFDPLNVLAPGQRIF 515 wild Malaysian banana
XP_006847935 520 KMFDPLQILAPGQRIF 535 Amborella trichopoda
XP_009412415 500 AQFDPLSILAPGQGIF 515 wild Malaysian banana
XP_002446804 505 ARFDPMHVLGPGQGIF 520 sorghum
A3AVP1       508 ARFDPLHVLGPGQGIF 523 Japanese rice
Q8LNV6       497 ARFDPRCILGPGQGIF 512 Japanese rice
XP_009390682 503 ARFDPLGILAPGHGIF 518 wild Malaysian banana
XP_009408161 494 SLFDPLSLLAPGQGIF 509 wild Malaysian banana
EFJ10917     511 LAYDPKAILAPGQNIF 526 Selaginella moellendorffii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap