6EKS


Conserved Protein Domain Family
Sial-lect-inser

?
pfam09264: Sial-lect-inser 
Click on image for an interactive view with Cn3D
Vibrio cholerae sialidase, lectin insertion
Members of this family are predominantly found in Vibrio cholerae sialidase, and adopt a beta sandwich structure consisting of 12-14 strands arranged in two beta-sheets. They bind to lectins with high affinity helping to target the protein to sialic acid-rich environments, thereby enhancing the catalytic efficiency of the enzyme.
Statistics
?
PSSM-Id: 401269
View PSSM: pfam09264
Aligned: 3 rows
Threshold Bit Score: 292.636
Threshold Setting Gi: 658304912
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EKS_A       323 DVTDQVKERSFQIAGWGGSELY----RRNT-SLNSQQDWQSNAKIRIVDGAANQIQVADGSRKYVVTLSIDESGgLVANL 397 Vibrio cholerae...
WP_005305077 345 NVSSHVKEKTLQIVGWSGSEFY----SKSLdEISSQNSWSLQSKLKIYNGKDNDLVVANGTKQYKISFAVNENG-LVAYL 419 Photobacterium ...
KEI73305     380 DITAQVRERAWDARGWSGKAAWsfdiTDALqTPAAG-NWSLVTDRKAIQGQ-ITDYLVTGEAILLPTVTVTEANnLVVNL 457 Endozoicomonas ...
6EKS_A       398 NGVSAPIILQSEHAKVHSFHDYELQYSALNHTTTLFVDGQQIT-TWAGEVSQENNIQFGNADAQIDGRLHVQKIVLTQQG 476 Vibrio cholerae...
WP_005305077 420 DDQNSAKLIRTTIQNIAGFINVAMDFDPVTQTAQLTIDDAVVG-TLSGIPSADKHILFGQTNAAHDGRLHIANINLNVNG 498 Photobacterium ...
KEI73305     458 NGTGGGDFTLLEDVGPAEFHTSEIRYDPVTKTASYLFDGEVIAsNWSGAPNSAKKVVFGNDLTNDEGRATYKSANFTIGE 537 Endozoicomonas ...
6EKS_A       477 HNLVEFDAFYLAQQTP-EVEKDLEKLGWTKIKTGNTMSLYGNAS 519 Vibrio cholerae O1 biovar El Tor str. N16961
WP_005305077 499 QRVIDYDAETLTDINPnEMNNTPESQGWSKHKSGRAYSFYGVAS 542 Photobacterium damselae
KEI73305     538 TTVIDYSASATP-----AAEATPVAQGWTAELAEKGRGILGWKS 576 Endozoicomonas elysicola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap