4ZFO


Conserved Protein Domain Family
BCMA-Tall_bind

?
pfam09257: BCMA-Tall_bind 
BCMA, TALL-1 binding
Members of this family, which are predominantly found in the tumor necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumor necrosis factor ligand TALL-1.
Statistics
?
PSSM-Id: 401263
View PSSM: pfam09257
Aligned: 8 rows
Threshold Bit Score: 56.3287
Threshold Setting Gi: 822599592
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ZFO_F         8 CSQNEYFDSLLHACIPCQLRCsSNTPPLTCQRYCNASV 45 
XP_008255958   5 CFQNEYFDNLLGTCKPCHLRC-SKAPPVTCQRYCNASV 41  rabbit
XP_015215688  54 CSPNDYYDKLMETCKPCYLRC-SKAPPSVCLTYCKQSV 90  spotted gar
XP_010595778  29 CFQNEYFDGLLYACKPCHLRC-SNTPPLSCQRYCNASM 65  African savanna elephant
XP_008527747   5 CVPNEYFDRLLNACKPCLLRC-PNTPPLVCERYCDAsn 41  Przewalski's horse
EOB02042       4 CPENEYFDNLVLSCKPCHLRC-SGTPPPSCENYCDKSa 40  mallard
O88472         5 CFHSEYFDSLLHACKPCHLRC-SN-PPATCQPYCDPSV 40  house mouse
XP_003269345   8 CSQNEYFDSLLHACIPCQLRCsSNTPPLTCQRYCNASV 45  northern white-cheeked gibbon
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap