5VYF


Conserved Protein Domain Family
Feld-I_B

?
pfam09252: Feld-I_B 
Click on image for an interactive view with Cn3D
Allergen Fel d I-B chain
Members of this family of cat allergens adopt a helical structure consisting of eight alpha helices, in a Uteroglobin-like fold. They are one of the most important causes of allergic asthma worldwide.
Statistics
?
PSSM-Id: 401259
View PSSM: pfam09252
Aligned: 15 rows
Threshold Bit Score: 102.421
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VYF_F         7 CPIFYDVFFAVANGNELLLDLSLTKVAATEPERTAMKKIQDCYVENGLISRVLDGLVMTTISSSKDC 73  domestic cat
XP_004765236  24 CPIFYSTFGALAIGERFPLDLNLDVVGATEPEKEALEKIQDCYNEKGLEAKGLDLIVMTTITTSNQC 90  domestic ferret
3_pfamImport   1 CLPFYITFGTVALRNSVLLKLDLIKYGATQEEYEAFRKIQECYAEHPIIRTAMDIKLMTMTTINKEC 67 
Q7M747        24 CVPFFAGYAGVISGSRLWLYHELSAFNGTPKETVAYEKIQDCYKEQGVKSQTLEPQILASILVTPEC 90  house mouse
Q8R1E9        24 CAPFVGAYVKILGGNRLALNAYLSMFQATAAERVAFEKIQDCFNEEPLTTKLKSPQIMMSILFSSEC 90  house mouse
Q8JZX1        24 CLSFARTYGAILTLRRTFLHGDLSQFYATVAERVAFEKIQDCFREEGQKTIILNPQIMLSLYLSPEC 90  house mouse
XP_005616787  24 CPLFYSVFGTLAIGKELPLNTALRLANATEAEKAAMGKIQDCYNEKGLDAKILDLIVMTTITTSKKC 90  dog
XP_012045542  27 CPIFYGVFGTVSLGSKTLLNATLDLVAATDEEKAALGKIQDCYNEAGLDGKFLDLLLMVSINLSTDC 93  sheep
NP_001193735  25 CPVFYGGVAALLLGSKTVLNSTLDLVDSTDEEKAAFGKVQDCFNEAGFDAKLKVVEIMGSIVFDKDC 91  cattle
XP_006046607  24 CPVFYGAVGTVFIGSKTLLNSTFDLVDATNEEKEAIGKLQDCFNENGFRAKLFIIELVSSiiinedc 90  water buffalo
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap