1YUI


Conserved Protein Domain Family
GAGA

?
pfam09237: GAGA 
Click on image for an interactive view with Cn3D
GAGA factor
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognizes the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognizes the A in the fourth position of the consensus sequence.
Statistics
?
PSSM-Id: 150045
View PSSM: pfam09237
Aligned: 3 rows
Threshold Bit Score: 91.1707
Threshold Setting Gi: 2780897
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YUI_A      1 PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV 54  fruit fly
Q17MR3    275 DGTAVIDTKDGIIKIKNKSQSEQPATCPICQAVIRQSRNLRRHLELRHFKKPGM 328 yellow fever mosquito
XP_309925 312 GYVTFFFRYFCLLEIKSKSQSEQPATCPICQAVIRQSRNLRRHLELRHFKKPGV 365 Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap