3OVU


Conserved Protein Domain Family
AHSP

?
pfam09236: AHSP 
Alpha-haemoglobin stabilizing protein
Alpha-haemoglobin stabilizing protein (AHSP) acts a molecular chaperone for free alpha-haemoglobin, preventing the harmful aggregation of alpha-haemoglobin during normal erythroid cell development: it specifically protects free alpha-haemoglobin from precipitation. AHSP adopts a helical secondary structure consisting of an elongated antiparallel three alpha-helix bundle.
Statistics
?
PSSM-Id: 401249
View PSSM: pfam09236
Aligned: 14 rows
Threshold Bit Score: 124.075
Threshold Setting Gi: 351711358
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OVU_A         5 ANKDLISAGLKEFSVLLNQQVFNDPL-VSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAK 83 
XP_017193256   6 TNKDLISMGLKEFNVLLNQQVFSDPL-LSQEAMQTVLDDWVNLYVNYYRQQMTGEQQELDKALEELRLELNGLAKPFLNK 84  rabbit
XP_003794315   6 ANEDLISAGVKEFNILLNQQVFNEPF-VSEEAMETVVNDWVNFYMNYYKKQMTGEQGEQEKALQELKQKLNSLANPFLAK 84  small-eared galago
Q865F8         6 TNKDLISKGIKEFNILLNQQVFSDPA-ISEEAMVTVVNDWVSFYINYYKKQLSGEQDEQDKALQEFRQELNTLSASFLDK 84  cattle
Q9CY02         6 SNKDLISTGIKEFNVLLDQQVFDDPL-ISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAK 84  house mouse
XP_003514834   6 TNKELISEGIKQFNVLLGQQVFDDPL-IPEENMVTVVNDWVNLYINYYKPLVFGKQQEQDKALQELQQELNTLGSQFLTK 84  Chinese hamster
ELW66310       6 VNKDIIATGMKKFSVLLDQQVFSEPP-ISEEAMVVVVNDWVNFYVNYYGQQVTGEQQEQDRALNELRQELTTMASPFLAK 84  Chinese tree shrew
XP_010596885   6 ANKDLISTGMKEFSILLNQQDMRDNP-IPEEAMVIVVNDWMSFYINYYRQKMTGEQQEQDRALQELQQGLNTLANPFLTK 84  African savanna...
XP_001515563   6 SNQDVINSAMAAFQALLNQQVFSPQIpIPMEAMKIIVRDWIEFYISYFAPKLRGDRQERERAQEDLWETLQAIARPFLDK 85  platypus
XP_003761380   6 SNQDVISSAMQEFSKLLDQQEFTKPA-FSETDMVTIVDDWIKFYLSYYSKKMTGNEQEQERAMQKLQEELRTSASPFLDK 84  Tasmanian devil
3OVU_A        84 YRDFLKS 90 
XP_017193256  85 YSVFLKS 91  rabbit
XP_003794315  85 YRAFLKS 91  small-eared galago
Q865F8        85 YRNFLKS 91  cattle
Q9CY02        85 YRTFLKS 91  house mouse
XP_003514834  85 YRTILKS 91  Chinese hamster
ELW66310      85 YRAFLKS 91  Chinese tree shrew
XP_010596885  85 YRDFLKT 91  African savanna elephant
XP_001515563  86 YRDFLNA 92  platypus
XP_003761380  85 YRaflkt 91  Tasmanian devil
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap