5YXC


Conserved Protein Domain Family
ZinT

?
pfam09223: ZinT 
Click on image for an interactive view with Cn3D
ZinT (YodA) periplasmic lipocalin-like zinc-recruitment
ZinT plays a critical role in recruiting periplasmic zinc to the bacterial zinc-uptake complex ZnuABC, consisting of families pfam01297,pfam00950, pfam00005, regulated by the transcription-regulator FUR, pfam01475. ZinT acts as a Zn2+-buffering protein that delivers Zn2+ to ZnuA (TroA), pfam01297. Members of this family of prokaryotic domains were first identified as part of the response of bacteria to a challenge with the toxic heavy metal cadmium. They are able to bind to cadmium, and ensure its subsequent elimination.
Statistics
?
PSSM-Id: 401241
View PSSM: pfam09223
Aligned: 41 rows
Threshold Bit Score: 282.972
Threshold Setting Gi: 503465924
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YXC_B           36 VEQKAANGVFDDANVQNRTLSDWDGVWQSVYPLLQSGKLDPVFQKKADADKTKTFAEIKDYYHKGYATDIEMIGIEDGIV 115 Escherichia ...
CCO13040         35 EQTKASQGIFEDSEVKDRELFDWEGSWKSIYPYLVDGSLDEVFEKKA-KDGDKTFEEYKEYYREGYQTDIDSIDINKGII 113 Carnobacteri...
CCH:MU9_3157     34 AQRKAAEGIFADKDVKDRQLSDWDGVWQSVEPYLASGELDPVMQAKAAKNGDKTAEEYRAYYTKGYKTDVDMIGIENNII 113 Morganella m...
CAR46625         35 aqiDAANGIFEDKDVLNRSLSDWDGVWQSVEPYLRSGELDIVLQKKAETKQDKTVEQYRAYYTQGYKTDVDMIGIENNIV 114 Proteus mira...
wugsc:KPN_04244  36 VERQASEGIFADKDVQDRALSDWEGVWQSVNPYLLNGDLDPVLEQKAKKPGGKSVEEYRAYYKKGYATDVEQIGIEDDVI 115 Klebsiella p...
wugsc:CKO_01827  23 MEQKAAEGVFDDKNVKDRALTDWDGMWQSVYPYLVSGELDPVFKKKAEKDNSKTAEEIKAYYRKGYATNVDTIGIENGVM 102 Citrobacter ...
CAX58682         36 VEQKAADGVFDDKNVKDRKLEDWDGVWQSVYPLLLKGELDPVFRKKAEKDKSKTFEDVKAYYRKGYATNIESIGIENGTM 115 Erwinia bill...
CDC24799        133 HEEDHHDGVFEDADVQDRTLADWQGDWQSVYPYLLDGTLDPVFAHKAAEKQDKTEAEYKAYYTAGYQTDIERITIDGDTI 212 Firmicutes b...
CDB29302        140 hdhskevSTFEDDEVQDRSLSDWAGDWQSAYPFALDGTLDDAFAAMA-EEGEMTAEEYKTYYQNGYKTDITNIDIEGDHI 218 Firmicutes b...
WP_004218486    348 laddpQHGWFLTQQVKDRTIADYAGQWRSVYPLLKNGKLRGVMEHKA-ATGDKTADEYTAYYDAGYKTDTETITIEGDRM 426 Bifidobacter...
5YXC_B          116 EFH-RNNETTSCKYDYDGYKILTYKSGKKGVRYLFECK-DPESKAPKYIQFSDHIIAPRK-SSHFHIFMGNDSQQsLLNE 192 Escherichia ...
CCO13040        114 SFH-MNDKWETAEYNYDGYEILTYESGKKGVRYLFSSV-ENNSKAPKFIQFSDHIIEPQK-SGHFHIYMGNESHKeLLSE 190 Carnobacteri...
CCH:MU9_3157    114 EFH-RGDKVDQCEYQYAGYRILNYTSGKKGARYLFECK-DKNSHAPKYIQFSDHIIAPEK-AGHFHLYMGNESQEaLLTQ 190 Morganella m...
CAR46625        115 EFH-RGDKVDSCEYHYDGYRILHYQSGKKGVRYLFRCD-DANSQAPRFIQFSDHIIAPEK-AQHFHLYMGNSSQDeLLKE 191 Proteus mira...
wugsc:KPN_04244 116 EFH-VGQTVNSCKYRYSGYKILHYASGKKGVRYLFECQ-QGDANAPKFVQFSDHIIGPRK-SQHFHIFMGNESQEaLLKE 192 Klebsiella p...
wugsc:CKO_01827 103 EFH-TGNQVESCQYDYAGHKILTYASGKKGVRYLFECK-DAKSNAPKYVQFSDHIIAPRK-SSHFHIFMGNTSQQaLLEE 179 Citrobacter ...
CAX58682        116 EFH-VGEQVSSCKYDYAGYKILNYVSGKKGVRYLFECH-DASSKAPKFVQFSDHIIGPRK-SSHFHIFTGNTSQQaLLAE 192 Erwinia bill...
CDC24799        213 AFF-ENGKPITAKYIYEGFRILTYESGKKGVRYQFQSA-DPASAAPKYIQFIDHEIGPVDhAEHFHIFMGNDGFDkLSEE 290 Firmicutes b...
CDB29302        219 EFTyEDGKKVGSDYQYDGYYIQNWSTGTKAAMYRFEAV-DRTSGAPVYIEFNDHMIEPAA-AEHFHIRMSNESFDaIVDP 296 Firmicutes b...
WP_004218486    427 AFT-TNGRKVTATYRYDGHRILDYAKGNRGVRYLFTATgDVPQGAPKAVQFSDHGIAPGK-AAHFHIFTGDSHDE-VIKQ 503 Bifidobacter...
5YXC_B          193 MENWPTYYPYQLSSEEVVEEMMSH 216 Escherichia coli K-12
CCO13040        191 MTNWPTYFPESMSKKDIIHDMLYH 214 Carnobacterium maltaromaticum LMA28
CCH:MU9_3157    191 LDNWPTYYPYTMSGKDIVHEMLHH 214 Morganella morganii subsp. morganii KT
CAR46625        192 LTNWPTYYPYSMKGEDIVHEMLYH 215 Proteus mirabilis HI4320
wugsc:KPN_04244 193 MDNWPTYYPYALHKEQIVDEMLHH 216 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
wugsc:CKO_01827 180 MDNWPTYYPYQLKAEEVVDEMLHH 203 Citrobacter koseri ATCC BAA-895
CAX58682        193 MDSWPTYYPFQMTDEQVVDEMLHH 216 Erwinia billingiae Eb661
CDC24799        291 MENWPTYYDSSLTGDEVLDEMLSH 314 Firmicutes bacterium CAG:466
CDB29302        297 ENSWPTFFPADMTGEEICEHMEGH 320 Firmicutes bacterium CAG:137
WP_004218486    504 MEHWPTYYPASMSDDEIVKEMLAH 527 Bifidobacterium animalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap