1M1C


Conserved Protein Domain Family
LA-virus_coat

?
pfam09220: LA-virus_coat 
Click on image for an interactive view with Cn3D
L-A virus, major coat protein
Members of this family form the major coat protein of the Saccharomyces cerevisiae L-A virus.
Statistics
?
PSSM-Id: 401239
View PSSM: pfam09220
Aligned: 2 rows
Threshold Bit Score: 870.485
Threshold Setting Gi: 199429913
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M1C_B     1 MLRFVTK-NSQDKSSDLFSICSDrGTFVAHNRVRTDFKFDNLVFNRVYGVSQKFTLVGNPTVCFNEGSSYLEGIAKKYLT 79  Saccharomyces cerev...
CAR65487   1 MLKFVNQlNSKGKNNLYHSQQTD-GTASTMSRIRVDFKYDDLTFSRSLTASQDYTWVGKVLTSMSEVESSLDGLNKKYLT 79  Debaryomyces hansen...
1M1C_B    80 LDGGLAIDNVLNELRSTCGIPGNAVASHAYNITSWRWYDNHVALLMNMLRAYHLQVLTEQGQYSAGDIPMYHDGHVKIKL 159 Saccharomyces cerev...
CAR65487  80 LDGAISTDNVFQELKNSAGFQSNIIAGHAYNVAGWRWYDNHVALLVNLLRFYILSDLDERSKLSTGKFPVYDDGHVIIDL 159 Debaryomyces hansen...
1M1C_B   160 PVT--IDDTAgpTQFAWPSDRSTDSYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMMSKWHRRTNLAIDYEAPQLA 237 Saccharomyces cerev...
CAR65487 160 NDTllLEDKA--VDWTWPGRRADESYPYWNPMTEFLPVTDDPHIDLRPLTEEEAKVVLMMTGEWKPQTNYKLDFYTPRLA 237 Debaryomyces hansen...
1M1C_B   238 DKFAYRHALTVQDADEWIEGDRTDDQFRPPSSKVMLSALRKYVNHNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHD 317 Saccharomyces cerev...
CAR65487 238 EKIMYRYRNPISSLNEWLDAEGTAPTYYLPKSRVIWSALRKYVTHNNLYNQFYTATNIVAQVMLTVYPDTAEGMTWLTHV 317 Debaryomyces hansen...
1M1C_B   318 ALVNIPKFGSIRGRYPFLLSGDAALIQATALEDWSAIMAKPELVFTYAMQVSVALNTGLYLRRVKKTGFGTTIDDSYEDG 397 Saccharomyces cerev...
CAR65487 318 PEVHLPKFGSVRGRYPFLNSGEAAFIQAKALEDWAALIAKPELLFTYGMMLASTLNIGLAVRDAKASLLIGEDKSSFDDT 397 Debaryomyces hansen...
1M1C_B   398 AFLQPETFVQAALACCTGQDAPLNGMSDVYVTYPDLLEF 436 Saccharomyces cerevisiae virus L-A
CAR65487 398 LFLTPETFFASAVSLATGLDAPLNGMGDVYVFYPELVNI 436 Debaryomyces hansenii CBS767
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap