1N81


Conserved Protein Domain Family
Pfg27

?
pfam09216: Pfg27 
Click on image for an interactive view with Cn3D
Pfg27
Members of this family are essential for gametocytogenesis in Plasmodium falciparum. They contain a fold composed of two pseudo dyad-related repeats of the helix-turn-helix motif, serving as a platform for RNA and Src homology-3 (SH3) binding.
Statistics
?
PSSM-Id: 401236
View PSSM: pfam09216
Aligned: 2 rows
Threshold Bit Score: 239.517
Threshold Setting Gi: 74873106
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1N81_A    1 YHYEH--ETHAPLSPRIRKVGDIEFHACSDyiYLLMTLSKDPEKFNyALKDRVSIRRYVRKNQNRYNYFLIEERVQDNIV 78   Plasmodium falcipar...
O96127 1008 YKYEDmlKRDKDLFTIINNICELEFNSTNN--YLMKIINNDKLKHN-SLNDNEAILKEITKTQNELFSLKLPLEIKVSMA 1084 Plasmodium falcipar...
1N81_A   79 NRISDRLISYCTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIRMLFDTYEYVKDVKFTDDQ 158  Plasmodium falcipar...
O96127 1085 LRISERLRAFVFDKDLTAYYIKKLKDIFKLETEAAKNYYYYVKCQKTFSDKKRLVNNLDSIKLYYESQINKNFISIPKDK 1164 Plasmodium falcipar...
1N81_A  159 YKDAAARISQFLIDVV 174  Plasmodium falciparum 3D7
O96127 1165 IPTAIYRISNLVNDLI 1180 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap