1MKF


Conserved Protein Domain Family
M3

?
pfam09213: M3 
Click on image for an interactive view with Cn3D
M3
Members of this family of viral chemokine binding proteins adopt a structure consisting of two different beta-sandwich domains of partial topological similarity to immunoglobulin-like folds. They bind with the CC-chemokine MCP-1, acting as cytokine decoy receptors.
Statistics
?
PSSM-Id: 117766
View PSSM: pfam09213
Aligned: 3 rows
Threshold Bit Score: 640.536
Threshold Setting Gi: 81925316
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MKF_A  14 SGVSTQSVDLSQIKRGDEIQAH------CLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWvSVEELGQEII 87 
Q2EHP3  38 SGVSTQSVDLSQIKRGDEIQAH------CLTPAETEVTECAGILKDVLSKNLHELQGLCNVKNKMGVPWvSVEELGQEII 111 Murine herpesvirus st...
P89653  22 SVVNIETYPFPEDDTKEDMRDYlflvqnCLLQDNFNATYCSDSFEKLDKRSHFTLPDTCNVKTTFLVNY-NRHKYGIFKF 100 Murine herpesvirus 68
1MKF_A  88 TGRLPFPSVGGTPVNDLVRVLVVAESNtpeeTPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGM 167
Q2EHP3 112 TGRLPFPSVGGTPVNDLVRVLVVAESNtpeeTPEEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGM 191 Murine herpesvirus st...
P89653 101 ESRLPLPTMASATSGRVIKVLVLAEAG----RPWKRHWANLAMVTYSNVVRLTDFNAKFRTRFSRIWSVTLDRHEVDLDL 176 Murine herpesvirus 68
1MKF_A 168 LTRATFLEQWPGAKVTVMIPYSSTFTWCGELgAISEESAPQPSLSARSPV---CKNSARYSTSK-FCEVDGCTAETGMEK 243
Q2EHP3 192 LTRATFLEQWPGAKVTVMIPYSSTFTWCGELgAISEESAPQPSLSARSPV---CKNSARYSTSK-FCEVDGCTAETGMEK 267 Murine herpesvirus st...
P89653 177 TFAGFLFAAPESVQLTLLMDYVPTFTWCGQI-SLNDPDLPVPSFQAIRTLpvmCFPMWRYLNGQdFHHQDGCHQESKWWN 255 Murine herpesvirus 68
1MKF_A 244 MSLLTPF---GGPPQQAKMNTCPCYYKYS-VSPLPAMDHLILADLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCA 319
Q2EHP3 268 MSLLTPF---GGPPQQAKMNTCPCYYKYS-VSPLPAMDHLILAGLAGLDSLTSPVYVMAAYFDSTHENPVRPSSKLYHCA 343 Murine herpesvirus st...
P89653 256 PTHIIPRlnpGTESHNITLNTCVCHVKYNdLQELDTAHRIKILTISNFFGFYKPLYVLVTYFGSSDVNVEGQAPPLQYCV 335 Murine herpesvirus 68
1MKF_A 320 LQMTSHD-GVWTS--TSSEQCPIRLVEGQSQNVLQVRVAptSMPNLVGVSLMLEGQQYRLEYFG 380
Q2EHP3 344 LQMTSHD-GVWTS--TSSEQCPIRLVEGQSQNVLQVRVAptSMPNLVGVSLMLEGQQYRLEYFG 404 Murine herpesvirus strain 72
P89653 336 VFIHRGNyGFFRTrqRGDPDCPCHFSLGRDEIVLVGHYV--DVKRIVGITIFFDGQEHRISYLG 397 Murine herpesvirus 68
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap