Conserved Protein Domain Family
Endonuc-MspI

?
pfam09208: Endonuc-MspI 
Restriction endonuclease MspI
Members of this family of prokaryotic restriction endonucleases recognize the palindromic tetranucleotide sequence 5'-CCGG and cleave between the first and second nucleotides, leaving 2 base 5' overhangs. They fold into an alpha/beta architecture, with a five-stranded mixed beta-sheet sandwiched on both sides by alpha-helices.
Statistics
?
PSSM-Id: 401230
View PSSM: pfam09208
Aligned: 4 rows
Threshold Bit Score: 373.053
Threshold Setting Gi: 501051386
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015010140 140 LRQKIIEKATQNIEQGLRSNILGSDAETSIVNLLNDKRNANLWNDYEALKHTVKSSTYHIYKSILGKLNLSEGiDKIIEV 219 Amphibacillus x...
WP_012103013 140 LRQKIVEKASQNIAQGLRANVLGNDAETSIVNLLNDLKNKALWNDYQNAQQTIKSSTYKIYKEILEKIDLKEGfDKILEV 219 Firmicutes
MA:Aflv_1983 142 LERFIESKGLENEKTGKRKAVEGKNFEKQIVSLLNHPSNIEKWNQSNA---TEDGYFYPTFQQIMNLIGISKN-EKIIKI 217 Anoxybacillus f...
Q5QUR0       179 qrsfsdELAQVEEKTGSYYGKSGNKFERFLVEELNEPNNLSAYQANEKACFEYD----TVLDSVVSELPIEKQ--HIQLL 252 Idiomarina loih...
WP_015010140 220 SATDNIPLLSNRGKPKTDIYVKIKTEKLKI-CSSISVKNTSKKTVTVHEGNVSDIIKALNLLESNpLTQALKDFEKVGSK 298 Amphibacillus x...
WP_012103013 220 TATNDIPLLSNRGKPKTDVSVTIKTNTKEL-IRNISIKNTREKTVTIHEGSVSDLISALKLSESDpLSQALIHFEKVGSK 298 Firmicutes
MA:Aflv_1983 218 KATNEIPKLETGGQPKTDILLTITTDRRSKeTFTFSCKRSSATYVSIHEYTAESFIEVLDIKDEK-LQEAFRKLQEVGGF 296 Anoxybacillus f...
Q5QUR0       253 EATDTITKLKNGGSPKTDIHLRVYLSPKEFhIANISVKNTIATRVSCHDYQAKDFVRVIAPDDSD-FRNLVEIFQEAGSW 331 Idiomarina loih...
WP_015010140 299 KNLLLKHPDSCRILDEK--LKYYNKELVGLFIFGLHSP--LVNNNAQIADLIIF----TNNFAIWSQDEYIDYYINEYcT 370 Amphibacillus x...
WP_012103013 299 KKLIAEHPNSDKILEEN--LKLYNRELIEFFIFGLHSP--LVNDKIQMVDLIIF----TNKFAVWNRDDYIKHYIEEYsG 370 Firmicutes
MA:Aflv_1983 297 TKLKEQYDDLYKVMEKE--LPNLNKKLAQWAYAGIGGYg---DQKIHWANYIIVfkndTKELEMEKMDDYITNILQNV-- 369 Anoxybacillus f...
Q5QUR0       332 KEFNSLTSEKGLVLDTDevLNPYMEKIIQWAVTGQHDAdyLIDEKIQLANFILTrnadSGACKMQSAKSYIEELKAAI-G 410 Idiomarina loih...
WP_015010140 371 KGQFGTPFRWTYPSKKRGQKIQIKG 395 Amphibacillus xylanus
WP_012103013 371 KGQFGTPFKWTYPSKKRGQKIQIKG 395 Firmicutes
MA:Aflv_1983 370 KGQMGTSFQWTYPSKKKGKAIQLKG 394 Anoxybacillus flavithermus WK1
Q5QUR0       411 KGR-GAPFSWTYPSKRRGQRIQLKM 434 Idiomarina loihiensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap