Conserved Protein Domain Family
ArabFuran-catal

?
pfam09206: ArabFuran-catal 
Alpha-L-arabinofuranosidase B, catalytic
Members of this family, which are present in fungal alpha-L-arabinofuranosidase B, adopt a beta-sandwich fold similar to that of Concanavalin A-like lectins/glucanase. The beta-sandwich fold consists of two anti-parallel beta-sheets with seven and and six strands, respectively. In addition, there are four helices outside of the beta-strands. The beta-sandwich strands are closely packed and curved with a jelly roll topology, creating a small catalytic pocket. The domain catalyzes the hydrolysis of alpha-1,2-, alpha-1,3- and alpha-1,5-L-arabinofuranosidic bonds in L-arabinose-containing hemicelluloses such as arabinoxylan and L-arabinan.
Statistics
?
PSSM-Id: 401229
View PSSM: pfam09206
Aligned: 44 rows
Threshold Bit Score: 282.992
Threshold Setting Gi: 123167774
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Caci_4972   45 PCDLYSAGGTPCEAAYSTTRALSVSYAGPLYQVQRASDGSRLDVRVRSAGGVVDVAPENSFCGGTTCTITELYDQTA-NA 123 Catenulispora...
SIPI:L083_5665 162 aCDIYAAGGTPCIGAHSTTRALYGSYNGPLYQVQRASDKAYTNVGLLSAGGVANAATQDSFCANTSCTITKIYDQTA-NH 240 Actinoplanes ...
jgi:Caci_4931   44 PCDVYASGGTPCAAAYSTVRALFASYNGPLYQVQRASDNSRTDVGLLAAGDYANGAAQVSFCAGTSCTITKIYDQTS-HH 122 Catenulispora...
jgi:Caci_5223   54 PCDIYASAGTPCVAAHSTVRALYASYNGPLYQVRRASDGATTNIGVTSAGGSANSDAQDTFCVQTACTITVVYDQSP-QH 132 Catenulispora...
SIPI:L083_1314  35 PCDIYASGGTPCVAAHSTTRALFGSYSGSLYQVRRWSDGATTNVGVLSAGGYANAATQDSFCSGTYCTIVRIYDQTS-RH 113 Actinoplanes ...
DU:RAM_17950    23 PCDIYAAGGTPCVAAHSTTRALFASYSGPLYQVQRTSDSAVRDIGLLSAGGVADAAAQDSFCAGTVCTITRVYDQTGsSG 102 Amycolatopsis...
jgi:Caci_4882   48 PCDIYAAGGTPCVAAHSTVRALYGAYNGPLYQVRRSSDSTTANIGVLSAGGTANAAAQDSFCAGTSCVITVVYDQSG-HG 126 Catenulispora...
jgi:Caci_2728  186 PCDIYAAGGTPCVAAHSTVRALYSAYGGALYQVRRSSDNATKDISVLTPGGYANAATQDSFCAGTSCVITVVYDQSG-HG 264 Catenulispora...
DU:RAM_16775   161 PCDIYASGGTPCVAAHSTARALYGTYAGNLYQVRRSSDNTTRNIGVRAAGGTADAAAQDSFCTGTSCVITVVYDQSG-RG 239 Amycolatopsis...
AEV85633       159 PCDLYAAGGTPCVAAHSTTRALLSTYNGALYQVRRASDHATRDIGVVSRGGPADAAAQDTFCAGTSCVITVLYDQSG-HG 237 Actinoplanes ...
jgi:Caci_4972  124 NHMPISPGtscsgcsHGiAGPGPN-GADIGASALALPVTVGGQPAYGALFNAqGIGYRIT-NAKNVPTGSQPEGVYMLTS 201 Catenulispora...
SIPI:L083_5665 241 NDLPISWG-------GLwKGPGPN-GADVGADAKALPITVGGHKAYGVKVTP-GVGYRVD-NAKNAPTGSQPEGIYMITS 310 Actinoplanes ...
jgi:Caci_4931  123 NDMPISSG-------GFwKGPGPN-GSDVGADASALPVTVNGHAVFGVKVHP-GVGYRID-NTVGVPTGAQPEGVYMVTS 192 Catenulispora...
jgi:Caci_5223  133 NNLTIEGG-----------GGANP-NADVAANANAAHIVVNGNKAYGVYVGP-GVGYRDD-NTSAIPTGHQPQGAYMVAS 198 Catenulispora...
SIPI:L083_1314 114 NDLTIAPG-----------GGANP-TADQGANAAALPVTAGGHKVYGVYISA-GNGYRNN-ATNGVATGSQPEGLYMVTE 179 Actinoplanes ...
DU:RAM_17950   103 NTLVYQGP-----------GGTGG--ADTAAVATTEAMTVGGHKAYALYIKP-GNSYFA--GGSGVPTGSSPEGEYMVTS 166 Amycolatopsis...
jgi:Caci_4882  127 NNVAYQGP-----------GGAGG--TDTPSNATSESLTVGGSKAYSLYINP-GNSYWHNgSATGMPLGSAPQGAYMVTS 192 Catenulispora...
jgi:Caci_2728  265 NSVAYQGP-----------GGAGG--SDTPASATRESLTAAGHKVYDLYINP-GNSYWHNgASSGMPVGSQPQGAYMVTS 330 Catenulispora...
DU:RAM_16775   240 NDLWYQGS-----------SVVPGsNQSSPAKATSEPLTVGGSKAYSLYINP-GNSYWRDgHATGVPTGSAPEGMYMVTS 307 Amycolatopsis...
AEV85633       238 NNLGYQGT-----------GGIGG--ADTAAGATREAVTVGGSRVYSLYINA-GNSYWRNgSASGIPTGSAPEGIYLVTS 303 Actinoplanes ...
jgi:Caci_4972  202 SNLTSNGCCFDFGAGESNDTDDGNATMNAIYYGTDCWTQN-----CTGPGPWVGGDLENGMYFSNTGA--NPTSIPSEKg 274 Catenulispora...
SIPI:L083_5665 311 SNYVNQWCCFDYGSGENSHTDTGNATMNAIEWGTACWFGDwgnnpCVGTGPWVEADLENGMYHTNTGSnkDPNNSGVHF- 389 Actinoplanes ...
jgi:Caci_4931  193 SNYYNSQCCFDFGSAETDHKDDGNATMNAIEWGNACWFGG-----CTGSGPWVEADLENGMFSTNRGPn-NADNPGVSH- 265 Catenulispora...
jgi:Caci_5223  199 GTHVNGGCCFDYGNAETNNRDNGNGHMEAVNLGTSCWSSP-----CNGTGPWITGDLENGLYQGAGa---NPSNTGNNS- 269 Catenulispora...
SIPI:L083_1314 180 GTHVNDRCCFDYGNAETNNMDTGNGDMDAIYFGNLCWFSP-----CA-AGPRVAADLENGLFAGGDGs--WTANTGRNS- 250 Actinoplanes ...
DU:RAM_17950   167 GTHVNNGCCFDYGNTETDHRADGNGAMDAINFGTECWFGG-----CSGTGPWVQADLENGLFAGGSKAw-NPNQVAQTS- 239 Amycolatopsis...
jgi:Caci_4882  193 GTHVNGGCCFDYGNSETDRHADGAGAMDAIYFGTSCWFGG-----CSGSGPWVQADLEYGLYSGGSQSw-NANQRAFSS- 265 Catenulispora...
jgi:Caci_2728  331 GLHVNSGCCFDYGNSETDRRADGAGAMDAINFSTSCWFGG-----CTGSGPWVQADLEYGLFPGGSSSw-NPNQRAFAD- 403 Catenulispora...
DU:RAM_16775   308 GTHVNSGCCFDYGNSETTRKADAAGAMDAINFGTECWFGG-----CQGSGPWVQADLEWGLYPGGSQQw-NPNQRALPS- 380 Amycolatopsis...
AEV85633       304 GTHVNGGCCFDYGNSETTRRADGAGAMDAIYFGTSCWFGG-----CSGTGPWVQADLEYGLYPGGSRTw-NPHQRAFPS- 376 Actinoplanes ...
jgi:Caci_4972  275 SFLTAWEKNnGTTNFTLKYGNGQQGGLTQSYSGALPN--GYNPMKVQPSIELGTGGD------NSIWGDGEFFEGAVLAG 346 Catenulispora...
SIPI:L083_5665 390 PFVSAWEKNnGTSNFTLKYGNAAGGGLTTPYSGALPK--GYSPMKTESSLLLGTGGD------NSHSGQGEFFEGAITAG 461 Actinoplanes ...
jgi:Caci_4931  266 PFVTAWEKNnGTSNFTLKDGDATTGGLTTTYSGALPN--NYSPMKVQPDVELGTGGD------NSNGGQGEFFEGAVTTG 337 Catenulispora...
jgi:Caci_5223  270 QFVTAMLKSnNQTTFEIEGGNSQSGGLTTWYNGSLPPn-GYTPMSLEGAIVLGTGGD------NSNASIGTFFEGVMTAG 342 Catenulispora...
SIPI:L083_1314 251 AFVTAVLKNnGTSTYAIKDGNAQSGGLATRYNGALPSqsGYRPMTKQGAIILGIGGD------NSNGSVGSFFEGVLTSG 324 Actinoplanes ...
DU:RAM_17950   240 PFVTAMLKNsGTTQMALQGANAQSGSLTKFYGGALPS--GYNPMHKQGAIILGSGGDcc--qtNRNDSAGTFYEGAMVKG 315 Amycolatopsis...
jgi:Caci_4882  266 RYVTAMLKNnGTSQFALKGGDAQSGGLTTLWNGALPP--GYSPMRQQGAIILGSGGDcca-sgGGNQSLGTFYEGAITAG 342 Catenulispora...
jgi:Caci_2728  404 KYVTAMLKNnGSTQMALKGGSAQTGSLTTLWSGALPR--GYNPMKQQGAIILGSGGDcc--asNTNLSLGTFYEGAIVAG 479 Catenulispora...
DU:RAM_16775   381 KFVTAMLKNnGTSRFALKGSNAQSGNLTTMWDGALPG--GYSPMKKQGAIILGSGGDcckpggGANLSAGTFYEGAMVAG 458 Amycolatopsis...
AEV85633       377 RFVTAMLKNnGTSRFAIKGSNAQSGALTTLWDGALPA--GYSPMRKQGAIILGSGGDcc--idNTNQSAGTFYEGAIVAG 452 Actinoplanes ...
jgi:Caci_4972  347 FPSDATENAVQAGVVAAGFA 366 Catenulispora acidiphila DSM 44928
SIPI:L083_5665 462 FPTDATENAVQAGVVAAGYr 481 Actinoplanes sp. N902-109
jgi:Caci_4931  338 FPSDATENSVQAAITSAGYS 357 Catenulispora acidiphila DSM 44928
jgi:Caci_5223  343 VPSDSADAAVQANIVAQGYS 362 Catenulispora acidiphila DSM 44928
SIPI:L083_1314 325 YPSDATEESVQANIVSVGYT 344 Actinoplanes sp. N902-109
DU:RAM_17950   316 YPSDATDAAVQANIAAAGYA 335 Amycolatopsis mediterranei S699
jgi:Caci_4882  343 YPSDATDNAVQANIAAAGYG 362 Catenulispora acidiphila DSM 44928
jgi:Caci_2728  480 YPSDATDSAVQASIVAAGYQ 499 Catenulispora acidiphila DSM 44928
DU:RAM_16775   459 YPSDATENAVQANVVAAGYr 478 Amycolatopsis mediterranei S699
AEV85633       453 YPSDATDNAVQAGIVTAGYr 472 Actinoplanes sp. SE50/110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap