1WY6


Conserved Protein Domain Family
DUF1955

?
pfam09205: DUF1955 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1955)
Members of this family are found in hypothetical proteins synthesized by the Archaeal organism Sulfolobus. Their exact function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401228
View PSSM: pfam09205
Aligned: 5 rows
Threshold Bit Score: 228.111
Threshold Setting Gi: 121722424
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WY6_A             12 MDAKKFLLDGYIDEGVKIVLEITKSSTKSEYNWFICNLLESIDCRYMFQVLDKIGSYFDLDKCQNLKSVVECGVINNTLN 91  Sulfurisph...
RogerUC:Ahos_2265   2 TEAKERIIDGYVKQGIELIEKTVSSNNISQANWVICNIIDAAKCEYLVEVLDSIGKIFDISVCGNVKRVISCYAKVGKYS 81  Acidianus ...
jgi:Msed_1413      13 MEAKESIISGDVKRGVEIIEKTVNSSNIKEANWVICNVIDAADCAYVVETLNAIGKIFDVTACGNLKRVISCFMRAGKDS 92  Metallosph...
Q97ZD6             13 IEAKRLILDGFVEQGIELLSKTISPENIKESNWIICNIIDTANCDAVVKTLDSIGKIFDISPCANIKRVVYCYALMNKMS 92  Saccharolo...
Q4J8B6             13 MDAKKLLSDGIIEEGDKIIKELAKSSPRDEYNWFICNIVDTISCDTLFVVLEDIGSNFDLSKCQNLRTIINCGIKLNINS 92  Sulfolobus...
1WY6_A             92 EHVNKALDILVIQGKRDKLEEIGREIlkNNe-vSASILVAIANALRRVGDERDATTLLIEACKKGEKEACNAVN-T 165 Sulfurisphaera...
RogerUC:Ahos_2265  82 EFVDIAINSIVNRGKKDQLDKVLNDV--GN---NGEFLYKLSLAYEKLHDLKKAQELRKKACDSGIPEACENINqV 152 Acidianus hosp...
jgi:Msed_1413      93 EFVDLALSALVQKRREDQLDKILAET--GEi--PAPLLLKLASAYGKIGNRKKEQELLKQACEKGLKEACRDINqI 164 Metallosphaera...
Q97ZD6             93 EYVDLALDVIVKANKKDSLDKLYNDL--KNekiNPEFLLKIGTAYKKLNAVRESNEVLRKACENGVKEACENIKeI 166 Saccharolobus ...
Q4J8B6             93 KYFDMALDYLTAQGKKEQLEDISKNLfkLNeqpKPEIVIKIANALKKIGSTREANDLMNEACKRGIKDACASV--V 166 Sulfolobus aci...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap