6FDO,6EML


Conserved Protein Domain Family
Rio2_N

?
pfam09202: Rio2_N 
Rio2, N-terminal
Members of this family are found in Rio2, and are structurally homologous to the winged helix (wHTH) domain. They adopt a structure consisting of four alpha helices followed by two beta strands and a fifth alpha helix. The domain confers DNA binding properties to the protein, as per other winged helix domains.
Statistics
?
PSSM-Id: 401225
View PSSM: pfam09202
Aligned: 28 rows
Threshold Bit Score: 94.9302
Threshold Setting Gi: 74621373
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6FDO_A         9 LRYMSRDDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGGCNKVLRELVKHKLIAwE---RTKTVQGYRLTNAGYDYLAL 85 
Q8ZYP5         9 YHELSKRDLRVLRVIEVGHRRYEFVPEELITKWARYRREEVLDSIRRLHYYGFLR-R---NLAPYKGWKITALGYDVLAL 84  Pyrobaculum aer...
Q8TMY0         9 FKKLDAKDFRILTGIETGMKHFEWVPVEELNKYTKLPFDKLEYRLKRLVKDKLVV-R---TTQPYEGFQIYFEGYDALAL 84  Methanosarcina ...
Q2FSW1         8 IKSLHKYELRILQSIEYLMSRYSWVPEEELVHNSRLSANEVHFRLSKLMEKGMVK-Y---SQVPYPGYCLIFNGYDTLAI 83  Methanospirillu...
Q8TWN2        11 LPEMEPEDFKVLRALELEMRRHDWVPFDRLLERTGLDEKELGYRLSRLDRWDMVV-RtrrQTVGYLGYQLRPEGYDALAL 89  Methanopyrus ka...
Q9HSL0         9 IAALDPEDFHLLSGVEHGMRFSEWVSREKLPEFSRLTPQEVDYRLDRMLDREFLE-R---KTIQYEGVQLTFAGYDVLAL 84  Halobacterium s...
WP_011321854   9 MAELEEPDFHLLSGIEHGMRFSRWVAEGKLPKFSRLDEEELTYRLDRCMDRELIE-R---KTIQYTGYRLTFEGYDALAL 84  Natronomonas ph...
Q5V0R0         9 MAELEPEDFHLLSGVEQGMRFSEYVAREKLTEFSRLTTEDVDYRLDRCADRGLVE-R---KTIQYEGFKLTFEGYDTLAL 84  Haloarcula mari...
Q5CYZ6        11 MRFISKDEWRILTAVEMGMRNHEYVSPQLIESISNLRRTGSYQLLQNLLRNKLVS-R---ESKIYEGYKLSYLGYDFLAL 86  Cryptosporidium...
XP_001705591  18 VDSLPPSYYRVLTAVEMGMKNHDYVPLNLVISLSGIRHGSIPHIVQELLKIKLIS-H---IGAPIDGYALTYMGYDYLSL 93  Giardia lamblia...
6FDO_A        86 KTL-SSR 91 
Q8ZYP5        85 HTLrVQR 91  Pyrobaculum aerophilum
Q8TMY0        85 NAF-VKR 90  Methanosarcina acetivorans
Q2FSW1        84 SHL-VKK 89  Methanospirillum hungatei JF-1
Q8TWN2        90 RAL-VDQ 95  Methanopyrus kandleri
Q9HSL0        85 HTF-AER 90  Halobacterium salinarum
WP_011321854  85 RTF-SER 90  Natronomonas pharaonis
Q5V0R0        85 HTF-AER 90  Haloarcula marismortui
Q5CYZ6        87 RAL-NKR 92  Cryptosporidium parvum
XP_001705591  94 NVM-KRR 99  Giardia lamblia ATCC 50803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap