1NRJ


Conserved Protein Domain Family
SRX

?
pfam09201: SRX 
Click on image for an interactive view with Cn3D
SRX, signal recognition particle receptor alpha subunit
Members of this family, which are predominantly found in eukaryotic signal recognition particle receptor alpha, consist of a central six-stranded anti-parallel beta-sheet sandwiched by helix alpha1 on one side and helices alpha2-alpha4 on the other. They interact with the small GTPase SR-beta, forming a complex that matches a class of small G protein-effector complexes, including Rap-Raf, Ras-PI3K(gamma), Ras-RalGDS, and Arl2-PDE(delta). Structurally the alpha subunit is SNARE-like.
Statistics
?
PSSM-Id: 370358
View PSSM: pfam09201
Aligned: 12 rows
Threshold Bit Score: 190.284
Threshold Setting Gi: 363750558
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NRJ_A         1 MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVanantdgFDFNLLTINSEHKNS-------PSF 73  baker's yeast
CCE92569       1 MFEQFCIFTPQGDVIYQFNCAGKKFLESQINRFLSQYITSPAPNEETY-------KKYNLLSVSGGLSGPgvq--gpRGF 71  Torulaspora del...
XP_002555315   1 MIDQFVVFTLKGQVLYHFNPQGRKLAENHINKVISHLITSPSKKEES--------GKYLLFKL--------------DNF 58  Lachancea therm...
XP_003645496   1 MIDQLAIFTVQGQLLCKYNALGKKFSEQQFNKFIHTLIAQSIATSN---------SKFPTLSV--------------DSH 57  Eremothecium cy...
Q6CTR2         1 MIDQFAVFTPAGNLLYGYNSLNKKFSETQINRFVSEFISQPVKDVT---------SKFPIIST--------------SDT 57  Kluyveromyces l...
XP_002498708   1 MLEQFVVFTSGGQVVYQFNCLGKKFAETQINRFISHLLSSPTIHNEDSs------RKYRIVEIAGNSNTSggnkaqsRGF 74  Zygosaccharomyc...
XP_004178320   1 MFEQLAILTPQGTVLYQYNPLGKKFQEAQINAFINQLIVSPATKKDDIt------KKFSVFVVNSSVSSKks----vKNF 70  Tetrapisispora ...
CCC70743       1 MFDQLTIFTPQGQVLFKYNCQGKKFAELQINTFISKIITSPVTQRG---------SKFNILNITNDSLSKsn----vRPF 67  Naumovozyma cas...
CCD24063       1 MFEQLAIFTLQGIILYQYNCQGKKFSEHQINAFISKLITAPATRDTTTa-----gGKFTILNVTNDSTLSttn-aysRSF 74  Naumovozyma dai...
Q6FSE1         1 MFEQLTIFTPQGEVLYYYNCYDRKFAEAQVNAVISHLLTSPISRDHGS-------SKYKLLSIPSVSKNA-------KPF 66  [Candida] glabrata
XP_001646743   1 MFDQLVIFTPTGEVLYEYNPLNKKAMLNQVNAFISHLVNMPVSKKDDIn------SKLTIINVTQEKST--------RSF 66  Vanderwaltozyma...
CCE63236       1 MFDQLAIFTPQGEVLYQYNPSGKKFAETQVNAFINHLMNSPISKKNDVh------SKFSLVNISPTVGDSsns--skLNF 72  Tetrapisispora ...
1NRJ_A        74 NALFYLNKQPELYFVVTFA-EQTLELNQETQQTLALVLKLWNSLHLSESILKNR-QGQNEKNKHNYVDILQGIEDDLKKF 151 baker's yeast
CCE92569      72 SAMFHISKQPELYYVVTYA-EQSLQLNEEAAEILRLSISLWNSLNVNEEIVRNL-SGRGSKNEHNFTDVVDGLDKDIETF 149 Torulaspora del...
XP_002555315  59 AAACFIGKQPPLVYLVTYA-AQDLELNQEAEQVLDLGFGLWDSLKLNNSVLQNL-SGKGVKNRHNYTWILEGCDSNLNKF 136 Lachancea therm...
XP_003645496  58 TFMFHETKQPFLYYVVSYSsSESLELNQEAEQVLNIAIKLWDSLGLNDAIRKNQdHAKSKKNRHNYTWLLEGAEDKLLQF 137 Eremothecium cy...
Q6CTR2        58 SYMYHETKQPHLFLVVSFAsSESIQLTAEAESVVVLATKLWESLGLNEVILDNI-SGKGKKNVHNFRFITEGASDQISKF 136 Kluyveromyces l...
XP_002498708  75 CSMYHVSRRPELYYVVTYA-EQSLQLNQEAEETLQVGINLWESLGLSEGVLDNI-NGKGSRNERNCIDVLTDLEEELEKF 152 Zygosaccharomyc...
XP_004178320  71 CAMFHVNKQPEIYFVVTYA-ELSLELNRDSEELLKLAIDLWDSLELSTSVSENLnQYKTNANEHSQVFILNDMEEDLSKY 149 Tetrapisispora ...
CCC70743      68 CSMFHVTKQPELYFVITYA-EQTIDLDKEAEKTLDLALKLWDSLDLNEEIQSNL-------KNKQHVDILYGMNEDLSKF 139 Naumovozyma cas...
CCD24063      75 CSMFYKTKQPEIYFVITYA-EQTIELDKEAEKTLDLATKLWNSLEINKSIQENL-------NSRDHIDILDGVNDGISKF 146 Naumovozyma dai...
Q6FSE1        67 TVLSHVSKQPELYFIITYP-EPSMELNNEAQEVLDVAIALWDSLPINDIIIKAA-KGTGKKNAFNCIDISGEISEDIEKF 144 [Candida] glabrata
XP_001646743  67 SAMFHISKQPELYFVITYA-EQSLELNNEAESTLNLVLALWDSLDLNQSILENM-KGKSGKNEHNYCEVLQDLNETIKTF 144 Vanderwaltozyma...
CCE63236      73 SSMFYISKQPELYYLVTFP-EQKLDLKNEAEETLNLALSLWDSLGLNDSILQNLkNRTETKNWHNYIDLLYGTENDFKKF 151 Tetrapisispora ...
1NRJ_A       152 EQYF 155 baker's yeast
CCE92569     150 DKYL 153 Torulaspora delbrueckii
XP_002555315 137 DEYF 140 Lachancea thermotolerans CBS 6340
XP_003645496 138 EQFF 141 Eremothecium cymbalariae DBVPG#7215
Q6CTR2       137 GSYF 140 Kluyveromyces lactis
XP_002498708 153 DQYL 156 Zygosaccharomyces rouxii
XP_004178320 150 DKYL 153 Tetrapisispora blattae CBS 6284
CCC70743     140 DKYL 143 Naumovozyma castellii CBS 4309
CCD24063     147 DQYF 150 Naumovozyma dairenensis CBS 421
Q6FSE1       145 DNYL 148 [Candida] glabrata
XP_001646743 145 DKYF 148 Vanderwaltozyma polyspora DSM 70294
CCE63236     152 KEYF 155 Tetrapisispora phaffii CBS 4417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap