Conserved Protein Domain Family
Endonuc-BsobI

?
pfam09194: Endonuc-BsobI 
Restriction endonuclease BsobI
Members of this family of prokaryotic restriction endonucleases recognize the double-stranded sequence CYCGRG (where Y = T/C, and R = A/G) and cleave after C-1. They catalyze the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates.
Statistics
?
PSSM-Id: 370354
View PSSM: pfam09194
Aligned: 9 rows
Threshold Bit Score: 516.2
Threshold Setting Gi: 169885475
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002759695               14 YLLHLNQSCDLETTYEAIRSGFIALALEKNQRATPLIAEARTLK-IIAQTVNNPRDLLNIPDIQAALLTASGISDKAKNY 92  Mi...
P0A457                      3 YQYHIQSNDDLVTPYQEVRAGFVALALERNRKATPFVEQARALK-IRVSQIERPQDLLQMRDIRPTLLAASGVSDKAAGH 81  No...
WP_014433037                6 YQNHLRSSDDLVTSYEATRAGFVALALEKNRRSTPYVAEARALQ-QAALQARTPVDLLAIEGIEAGLLTAAGLSDKALVH 84  Ca...
CCW34780                    6 YHDHLESSEDLVTTYEATRTGFVALALEKNRRATPFVVEARALQ-EAASKAKTPIDLLNINGIETGLLTAAGLSDKALVH 84  Ch...
WP_015955012                4 YHNHLQSSDNLITTPEAARAGFVTLALEKNRRATPYIVEARALQ-TAASNAKRPAELLEIKEIEKGLLTAAGLSDKSLKH 82  Gl...
WP_015143106                4 YLNHLQSSDDLVTTYEATRAGFVALALEKNRRATPYVAEARALQ-AAANQVRNPADLLNVQGIEMGLLTAAGLSDKSLAH 82  Pl...
wustl:cce_1072             14 YKKHLSSWESLVTSYEQTRAGFISLALEKNRKATPFVEEAKALK-SIASTIESPIELINITQIKSALLTASGVSDKAKKY 92  Cr...
dbpsupku:SYNPCC7002_A1189   4 nnQFVNNSSDLVTTKDARRSGFLEYALRRNKESIPFIDKAKALQvSLQKNTKCAEDILKLYDIRETLIEAAGVSVKAKAH 83  Sy...
CDC57121                    3 eeLYIKCAEELVTSHEQTRAGFIEAALAKNYKAKPYIEQAKTLK-SLASCVSTPAELLNIPEIRNCLLTASGLSDKSLKY 81  Ba...
WP_002759695               93 LHSQDKVEAIQELIVNFLEPAGTNFVEELVYRFLLIRGDTLGGIMRNAGGSLAQSKFTRSLLATLRVAGIAYDWL---NS 169 Mi...
P0A457                     82 LQEQDKVDAIEGLIQNFLEPAGENFVEELVYRFLLTRGDTLGGSMRNVGGILAERKFARYIISALTLSNTSYKWL---DK 158 No...
WP_014433037               85 LLPEDKVEAINSLIKNFLEPAGEKFVEELVFRFLLTRGDTLGGSMRNIGGVLAQRKLTRAIISSLRIAGIAYRWQ---HS 161 Ca...
CCW34780                   85 LQSEDKIEAIKSLIKNFLEPAGEKFVEELVYRFLLTRGDALGGSMRNIGGALAQRKITRAIVSTLRIAGIEYRWQ---HL 161 Ch...
WP_015955012               83 LNWEDKVEAINGLIRNFLEPAGEKFIEELVFRFLLTRGDTLGGSMRNVGGALAQRKLTRAILSTLTIAGISYHWL---HL 159 Gl...
WP_015143106               83 LTAEDKIDAINGLIKNFLEPAGANFVEELVFRFLLTRGDTLGGSMRNVGGALAQRKLTRAILSTLTIAGQSYHWQ---HS 159 Pl...
wustl:cce_1072             93 LTENDKNEAIKRLIENFLEPAAKDFVDELGYRFLLTRGDSLGGIIRNLGGVLGERKMTRMLIATLSIQGISYCYL---HS 169 Cr...
dbpsupku:SYNPCC7002_A1189  84 LDDMDKNEILAGFVKEVLAPCGKKYIDEIVYRYLLTLGDALGGKMRNIVGSIAEEKFVRFIVAQLQVHDIEFELF----P 159 Sy...
CDC57121                   82 FTEEDKDEAIKKLISEFLEPTGATFVDELVYRFLLIKGDSLGGSMRNYVGLIAQMKLIRKLLSLLSMQKISFMVLfknDK 161 Ba...
WP_002759695              170 SNNQWREAE-EMTPNLEILVRGVSWLNNSQPRTIIYNVNVPIVnNNNIDLCLLKCDSTQLANQKIKKqtlqsADLY-IAL 247 Mi...
P0A457                    159 NSKTWLNQP-DDDTDIELRLRGLSWNLEGRNRTFIYNVNVPIV-RKNIDICLFDCRQNEIEKNIISN-----PNIY-IAL 230 No...
WP_014433037              162 KTRQWADMA-DDDSEIELSLRGLSWENNGKLRTLVYNLTVPLV-KNNVDICLFNLGPDELQATRYQS-----AGSY-LAL 233 Ca...
CCW34780                  162 MTRQWIDVS-GDDAEIELSLRGLSWRIQGKHRTLIYNLTVPLV-KSNVDMCLFSLDPQELQATEFKI-----PESY-FAL 233 Ch...
WP_015955012              160 KTKKWAAMT-NDDSEIELSLRGIYWESDRGSRTLIYNLNVPIS-NSNVDMCLFNLTPTELLNSKYTI-----VESY-IAL 231 Gl...
WP_015143106              160 KTKKWIAMT-NDDAEIELSLRGLSWESDLGRRTLIYNLNIPLV-KSNVDLCLFNLAPEALPANKSSKiepveVEPYtIAL 237 Pl...
wustl:cce_1072            170 KSKEWIVGS-QDDADVEIFLKGLSWNKSNQARTLIYNLTVPIV-KKNVDLCLLDAKPEQFMRRNNKNschyfPSNY-IAL 246 Cr...
dbpsupku:SYNPCC7002_A1189 160 KRSQWISNK-NYRAEMAARTKALRWKNKTTYRSLIFNINVPQV-KKNIDIVLLNDKIEGVTSSILANil-ndKNKY-LAI 235 Sy...
CDC57121                  162 KENKWQSLDyEHIFDKADEVAAIQWNNKQGSRILFFNATIPLV-KNNIDICLYQGGIEDFDSGNIVKk----DDKA-ILL 235 Ba...
WP_002759695              248 GELKGGIDPAGADEHWKTARTALQRIDDAFRKISKHPYTFFIGAAIETKMAREIYQQLETKKLTNAANLTNDNQLVSIMR 327 Mi...
P0A457                    231 GELKGGIDPAGADEHWKTANSALARIRTAFDRHSLKPYTFFVGSAIEKSMAEEIWHQLNSGILTNAANLTQPDQVASLCA 310 No...
WP_014433037              234 GELKGGIDPAGADEHWKTARAAFDRIREAFSKTKHSPHTFFIGAAIEKKMASEIWDQLERGLLTNAANLNDPNQIASVSR 313 Ca...
CCW34780                  234 GELKGGIDPAGADEHWKTARAAIDRIRQAFSKAGYSPHTFFIGAAIERRMADEIWNQLETGLLSNAANLNNHRQVASISR 313 Ch...
WP_015955012              232 GELKGGIDPAGADEPWKTARTALDRIREAFSTLGHSPHTFFVGAAIERKMAEEIWSQLYNGTLSNAANLNQENQVASISL 311 Gl...
WP_015143106              238 GELKGGIDPAGADEHWKTAQAALNRIRQAFADAGHSPLTFFVGAAIERRMAGEIWEQLQSGMLSNAANLNEENQVASISR 317 Pl...
wustl:cce_1072            247 EELKGGIDPAGADEHWKTANSALNRIKKAFLSNDLHPKTFFIGAAIEKAMAKEIFNQLDAKHLSNAANLTDDNQLISLCE 326 Cr...
dbpsupku:SYNPCC7002_A1189 236 GELKGGIDPAGADEHWKTANTALSRVRDSF---KNKIHLFFIGAAIETSMSAEIYEQCQTGELSNAANLTVDNQLSALCE 312 Sy...
CDC57121                  236 GELKGGIDPAGADEHWKTGSSALERIREAFA--GHSIKTSFIAAAIEKKMATEIYTQLQDGTLQNAANLTVDGQLTAYCN 313 Ba...
WP_002759695              328 WLCHL 332 Microcystis aeruginosa
P0A457                    311 WFIQL 315 Nostoc sp. PCC 7120 = FACHB-418
WP_014433037              314 WLCML 318 Caldilinea aerophila
CCW34780                  314 WLCGl 318 Chthonomonas calidirosea T49
WP_015955012              312 WLCNL 316 Gloeothece citriformis
WP_015143106              318 WLCSL 322 Pleurocapsa minor
wustl:cce_1072            327 WLINL 331 Crocosphaera subtropica ATCC 51142
dbpsupku:SYNPCC7002_A1189 313 WLITq 317 Synechococcus sp. PCC 7002
CDC57121                  314 WMINL 318 Bacteroides coprophilus CAG:333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap