1V8C


Conserved Protein Domain Family
DUF1952

?
pfam09189: DUF1952 
Domain of unknown function (DUF1952)
Members of this family are found in various Thermus thermophilus proteins. Their exact function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401219
View PSSM: pfam09189
Aligned: 3 rows
Threshold Bit Score: 63.1591
Threshold Setting Gi: 42543905
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V8C_A        93 FGAFPPWLLERYLEEWGGTREGEGvYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR 165
WP_013458124 105 LGGVSPWLLADYLRRWGAVEADDG-WRVDGAWVRFRALPPRVVGGLRTSRLEVEVGGAEARRWAERISVGAMR 176 Oceanithermus profundus
Q5SLZ2        94 FGAFPPWLLERYLEEWGGTREGEGvYRLPGAVVRFREVEPLKVGSLSIPQLRVEVEGEEAERWFERIAFAASR 166 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap