1Q8C


Conserved Protein Domain Family
DUF1948

?
pfam09185: DUF1948 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1948)
Members of this family of Mycoplasma hypothetical proteins adopt a helical structure, with one central alpha-helix surrounded by five others, in a NusB-like fold. Their function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401216
View PSSM: pfam09185
Aligned: 2 rows
Threshold Bit Score: 257.288
Threshold Setting Gi: 37928041
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q8C_A  12 LTRTQRRIAVVEFIFSLLFFLPKEAEVIQADFLEYDTKERQLNEWQKLIVKAFSENIFSFQKKIEEQQLKNQLEIQTKYN 91  Mycoplasma genitalium
P75084  29 LTRTQRRIAIVEFIFATLFFLPKTADQIQAAFLDYDVPERPLNDWQKEIVKVFSERCVEFIELIENQQQRNQAEVQSKYN 108 Mycoplasma pneumoniae...
1Q8C_A  92 KISGKKIDLLTTAVVLCALSEQKAHNTDKPLLISEALLIMDHYSQGAEKKQTHALLDKLL 151 Mycoplasma genitalium
P75084 109 KVSGKKVDLLTKAVILCALSEQHAQATDKPLLISEALLIMDHYSQVPEKKQTHALLDKLL 168 Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap