Conserved Protein Domain Family
PPP4R2

?
pfam09184: PPP4R2 
PPP4R2
PPP4R2 (protein phosphatase 4 core regulatory subunit R2) is the regulatory subunit of the histone H2A phosphatase complex. It has been shown to confer resistance to the anticancer drug cisplatin in yeast, and may confer resistance in higher eukaryotes.
Statistics
?
PSSM-Id: 401215
View PSSM: pfam09184
Aligned: 26 rows
Threshold Bit Score: 128.772
Threshold Setting Gi: 387514374
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCD26948       7 LNSSIHNMMGIKSRRLYEYLNDILITKKVKLSNSSNepiPFDLLINdFIPHMIDVTPN----------ESFInsneenie 76  Naumovozyma dai...
Q9W2U4        14 LERFTDLKQKEIPKELEEYLQYVAKTGDTIFKWSSLkylFREKLLS-VIKHFNEDSPRleeipnypnvDPFN-------- 84  fruit fly
EKC35391      11 LNDFEKKK-GEIPPVLEQYLKTIAKTGETLFPWPRVkplFVGKLEN-VMSKFNRELPAdhlap-cpnvENPK-------- 79  Pacific oyster
Q6P964        10 FRDFEKKGEKESCPILDQFLSHVAKTGETMIQWSQFksyFLFKLEK-VMDDFKASCPEqrgpa-npnvEYIP-------- 79  zebrafish
A1L1M4        10 LKDFDKKVKKEASTVLDQFLCHIAKTGETLVSWSQFktyFVFKLEK-VMEDFHASAPEqrgpa-npnvESIP-------- 79  zebrafish
XP_005814738  10 LRDFDKKAKKEPIPLLEQFLCHVAKTGQTMVPWSQFknyFLFKLEN-VMDDFKASTPEqrasa-npnvESVP-------- 79  southern platyfish
Q5ZMU6        10 LKDFEKRGKKEVCPILDQFLCHVAKTGETMVQWSQFkgyFIFKLEK-VMDDFRTSAPEprgpp-npnvEYIP-------- 79  chicken
XP_003439001  10 FQDFEKKGKKETCPLLEQFLCHIAKTGQPMIPWSQFktyFMFKLEK-VMDDFHAATPEqrgph-npnvEFVP-------- 79  Nile tilapia
XP_031172366  10 FQDFEKKGKKETCPELEQFLCHVAKTGQPMISWSQFktyFVFKLEK-VMDDFHASTPEqraph-npnvDYIP-------- 79  pike-perch
CAF96915      10 LRDFDKKAKKETCPLLEQFLCHIAKTGETMVQWSQFknyFLFKLEK-VMDDFRASAPEqrgpv-npnvESIP-------- 79  spotted green p...
CCD26948      77 sirrLKEMGENLIDKFFNNEKLPFTIMRIFELCFDPFKYFKvnELVKYVNALEKCCYVDSCLtlasSSSsSTNTEERRDE 156 Naumovozyma dai...
Q9W2U4        85 ----YETMKSSLLERLDLFNAAPFTVQRLCELLIDPRKQYS--RIDKFMRALEKNILVVSTIdpgrKRT-ESE------N 151 fruit fly
EKC35391      80 ----FKEMRKRILDSLNKFSDAPFTIQRLCELLTDPKKHYR--RTDKFLRGVEKNMLVVSTVdpfgNKI-VSESREVMVN 152 Pacific oyster
Q6P964        80 ----FEEMKQRILKIVNGYNGIPFTIQRLCELLTEPKRNYA--GTDKFLRGVEKNVMVVSCVyptsEK-----------K 142 zebrafish
A1L1M4        80 ----FEEMKERILKIVNEYNGIPFTIQRLCELLTEPKRNYT--GTEKFLRGVEKNVMVVSCIyptsEK-----------N 142 zebrafish
XP_005814738  80 ----FEDMKERILKIVKGYNGIPFTIQRLCELLTEPKRNYT--GTDKFLRGVEKNVLVVSCVhptsEK-----------N 142 southern platyfish
Q5ZMU6        80 ----FEEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYT--GTDKFLRGVEKNVMVVSCVypssEK-----------N 142 chicken
XP_003439001  80 ----FEEMKTRILKIVDGYNGIPFTIQRLCELLMDPKRNYT--GTDKFLRGLEKNVMVVSCIyptsEK-----------N 142 Nile tilapia
XP_031172366  80 ----FEEMKSRILKIVDGYNGIPFTIQRLCELLTDPKRNYT--GTEKFLMGLEKNVMVVSCVyptsEK-----------N 142 pike-perch
CAF96915      80 ----FEDMKERILKIVKGYNGIPFTIQRLCELLTEPKRNYT--GTDKFLRGVEKNVMVVSCVyptsEK-----------N 142 spotted green p...
CCD26948     157 EESNGNTIGEd-----------------------------gDASLVKIPWITEKDMGQLLPIVKEI--DVIMNVEFDDDD 205 Naumovozyma dai...
Q9W2U4       152 GDSLDSVVNGdlsmevnidiemennngnadegsspgagsagCAQKASCPRSDDND--QPKAKKAKL--EID------GEE 221 fruit fly
EKC35391     153 GMEG-SPVNGnea-------------------------dssPTTTPNIGPSLYPGAIPLQQTNWTT--DSWAGVGTSQEA 204 Pacific oyster
Q6P964       143 GSSCVNRMNGvmfpgntsafpd-------rnvngpgtprplNRPKHSLSSNVATNGLPDSTESKEQ-----------ASE 204 zebrafish
A1L1M4       143 GCSGVNRMNGvmlsgntsafte-------rkvngpgtprplNRQKHSMSSSLATNGLPDSTENKDT--N--------TPQ 205 zebrafish
XP_005814738 143 GCSTVNRMNGvmlpgnasafie-------rkvngpgtprplNRPKVSLVNSLAANGLPDSTDNKDL--N--------TEQ 205 southern platyfish
Q5ZMU6       143 NSSSLNRMNGvmfpgnspgyser------snvngpgtprpvNRPKVSLSTPMTTNGLPDSTEHKES--S--------LQQ 206 chicken
XP_003439001 143 GASSINRMNGvmfpgnsslytd-------rnvngpgtpkplNRPKLSLPTSLSTNGLPDCPVSKEP--EPA------TEE 207 Nile tilapia
XP_031172366 143 GASSVNRMNGvmfpgnsslysds------rnvngpdtpkplTRPKLSLSASLSTNGLPDCAVSKEPelT--------TEE 208 pike-perch
CAF96915     143 GCNAVNRMNGvmlpgntaafte-------rkvngpgtprplNRPKGSLGSSLAANGLPDSTDNKDL--K--------AEP 205 spotted green p...
CCD26948     206 EDDDEEDDeehhdvngqgtirerkSNKhGGTSTDDISITLQNDKDFIIEEyyeddddddddmnvedtnknlTNTPD-DEE 284 Naumovozyma dai...
Q9W2U4       222 RSEASDe---------------------TD----TEVATRVK-----------------------------------NEK 241 fruit fly
EKC35391     205 ARDTTCNEdppp--------gagaPATdSTPHVSVKEEEKEAPPDSNLET---------------------TDGDQ-APS 254 Pacific oyster
Q6P964       205 QSERTVn---------------------ESSASEAE----SHSGAVKSKH---------------------------RDD 232 zebrafish
A1L1M4       206 GHSKTTs---------------------DASASGIGG---PLGSSVKNKH---------------------LD----DEE 236 zebrafish
XP_005814738 206 DDNQDTs---------------------NVLPSEG-----SPGSAVKNKH---------------------SDE---EEE 235 southern platyfish
Q5ZMU6       207 TEDKKHs---------------------DSPASDSEG---AQSSPVKNKH----------------------------SE 234 chicken
XP_003439001 208 VEEQGIs---------------------ETSLSEGEM---TPNSGIKNKH----------------------------PE 235 Nile tilapia
XP_031172366 209 VEEHHFg---------------------DSSPSEG-EI--TPNSGIKNKH-------------------------PeEEE 239 pike-perch
CAF96915     206 SDDKDSs---------------------EVSASED-----SPGSSVKNKH---------------------------ADA 232 spotted green p...
CCD26948     285 EQDDDYVDDNMGDTSGDDDDDDADENDEND 314 Naumovozyma dairenensis CBS 421
Q9W2U4       242 DEKND--NDET--DSPHEAAEIEEPDEEVD 267 fruit fly
EKC35391     255 EESPPLKKSKLSDEISDEVPELASSKDDTR 284 Pacific oyster
Q6P964       233 EDATHAETHEAKRLKFDKEEEEEEDDEEED 262 zebrafish
A1L1M4       237 DEGMEEEEHEVKRLKFSQDGNEDEEDEDDV 266 zebrafish
XP_005814738 236 EEDMEAEHQEVKRLKFCKDEEEEEQEVETP 265 southern platyfish
Q5ZMU6       235 DDPAEAEGHEVKRLKFDKEGEARDAPNQSA 264 chicken
XP_003439001 236 EEDSDGDKQEVKRLKFDETEENETTSEKNE 265 Nile tilapia
XP_031172366 240 EEDSDAGKHEVKRLKFDekeedeteseekk 269 pike-perch
CAF96915     233 EEDMDADQQEVKRLKFSKEEEEDDEEEEEe 262 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap