1MJE


Conserved Protein Domain Family
BRCA-2_helical

?
pfam09169: BRCA-2_helical 
Click on image for an interactive view with Cn3D
BRCA2, helical
Members of this family adopt a helical structure, consisting of a four-helix cluster core (alpha 1, alpha 8, alpha 9, alpha 10) and two successive beta-hairpins (beta 1 to beta 4). An approx. 50-amino acid segment that contains four short helices (alpha 2 to alpha 4), meanders around the surface of the core structure. In BRCA2, the alpha 9 and alpha 10 helices pack with BRCA-2_OB1 (pfam09103) through van der Waals contacts involving hydrophobic and aromatic residues, and also through side-chain and backbone hydrogen bonds. The domain binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome.
Statistics
?
PSSM-Id: 401201
View PSSM: pfam09169
Aligned: 16 rows
Threshold Bit Score: 248.8
Threshold Setting Gi: 170054383
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MJE_A         25 MSSLQSARDLQDMRIKNKER--RHLRLQPGSLYLTK-SSTLPRISLQAAVGDRAPSACSPKQLYIYGVSKECINVNSKNA 101  house mouse
XP_001863104  951 LDARRLARERQRECGDGRTKpeQERRPRLYEFVRRK-KQQSGRISLRAFVGGERVGGGAGDGGSSRGVAERIRMLSVDNV 1029 southern hous...
XP_016848100 1810 IASLHCARNLQEMRILKKQK--QVIGPQPGTLYLMKiCATSCRIPLKTAVDEKCPGSYFSEQLYAFGVSKQCLNVNSSNA 1887 green anole
NP_989607    2427 MANLHCARDLQEMRIKKKYR--QNISPQPGSLYVTK-TSARNRISLKTAVEEETPSFHSTEKLYTYGVSKHCIQVNSTNA 2503 chicken
XP_015197522 2208 IQNLDFARGMQEMRIRKKKR--QTIRPLPGSLCLTK-TSGVSRVSLRAAVGGKSPAQHTQQQLYVCGVNRCVLEISSENA 2284 spotted gar
XP_005455063 2443 LQNTELAQDMQDMRIRKKKR--QNIRPLPGSLYLKK-TSGVPRIPLKAAVNGKIPGRYTPKKLYGYGVQKYVSDITSENA 2519 Nile tilapia
XP_022524494 1925 sQSLELARDMQDMRIRKKKS--QTIRPLPGSIYLAK-TSGVTRISLREAVNNKCPLLHSQEKLYQYGVHCQVSQITAENA 2001 Mexican tetra
XP_005157420 2026 QESLQLARDMQDMRLRKKKR--QTIRPVPGSLYLAK-TSGVSRKSLRDAVGCTCPSQYTQDELSQHGVHHKVLEITSENA 2102 zebrafish
XP_028429064 2121 lhNVELARDMQDMRIRKKKR--QTIRPLPGSLFLTK-TSGVSRIPLKAAVngkpparYTPKQLYGHGVHQHVCEITSETA 2197 yellow perch
ABQ42581      147 LHNVELARDMQDMRIRKKKR--QTILPLPGSLFLKK-SSGVTRIPLKSAVNGKPPARYTPKQLYGLGVPLNVLEITSETA 223  spotted green...
1MJE_A        102 EYFQFDIQDHFGKEDLCAG-KGFQLAD-GGW--LIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAA 177  house mouse
XP_001863104 1030 AEFKFEVEAFYGKQFAQENtTGIPLGDpDALihVILDDNSHVGLPEFTSAFLAAPGIDPTLVPSGWIVNAWKWILLKLAS 1109 southern hous...
XP_016848100 1888 EHFQFHIQDFFGRECFLDG-NGIQLAD-GGY--LIPTDDGKAGKEEFYRALCDTPGVDPKLISKAWVYNHYKWIIWKLAA 1963 green anole
NP_989607    2504 ESFQFLIEEFFSKEYLLAG-NGIQLAD-GGW--LIPTDEGKAGKKEFYRALCDTPGVDPKLITEAWVYNHYRWIVWKLAA 2579 chicken
XP_015197522 2285 ESFRFSCRDHFGIEFFSAG-NGVQLAD-GGC--LIPDNKGTAGKEEFYRALCDTPGVDPKLISESWVYNHYRWIVWKRAA 2360 spotted gar
XP_005455063 2520 ESFRFNLLQFIKREAFTDE-GGVQLAD-GGW--LVPSNDGTAGKEEFYRALCDTLGVDPKLISEAWVYNHYRWIVWKQAS 2595 Nile tilapia
XP_022524494 2002 ELFRFNFDDFFKREMFIDN-TGVQLAD-GGW--LIPDNRGTVGKEEFYKAMCDTPGVDPKLMSEAWVFNHYRWVVWKRAC 2077 Mexican tetra
XP_005157420 2103 ESFRFDCSDYFTCEHLMES-GALQLAD-GGW--LVPDSKGTVGKEEFFSALCDTPGVDPKLISDVWVFNHYRWIIWKRAS 2178 zebrafish
XP_028429064 2198 ESFRFNLQQFLKQEAFIDG-GGVQLAD-GGL--LIPSNDGTAGKEEFHRALCDTPGVDPKLISEGWVYNHYRWIVWKQAS 2273 yellow perch
ABQ42581      224 GSFRFSLQQFVKLESLTDK-GGIQLAD-GGW--LIPRNDGTAGKEEFYRALCDTTGVDPKLISEEWVYNHYRWIVWKQAS 299  spotted green...
1MJE_A        178 MEFAFPKEFANrCLNPERVLLQLKYRYDVEIDnS 211  house mouse
XP_001863104 1110 MERQLPKLFCD-VTSPVNVLDQLLFRYHVEID-C 1141 southern house mosquito
XP_016848100 1964 MEVAFPQEFASkCLTPERVLLQLKYRYDVEVDkS 1997 green anole
NP_989607    2580 MEVCFPHKFANrCLTPETVLLQLKYRYDLEIDkS 2613 chicken
XP_015197522 2361 MERAFPLEMGSrCLTPEQVLLQLKYRYDLEIDnS 2394 spotted gar
XP_005455063 2596 MEKSFPEIVGSrCLTPEQVLLQLKYRYDVEVDhS 2629 Nile tilapia
XP_022524494 2078 MERTFPEVMGGrCLTPEQVLLQLKLRYDTEVDnS 2111 Mexican tetra
XP_005157420 2179 MERTFPNLIGGlCLTPEQVLLQLKFRYDVEVDhS 2212 zebrafish
XP_028429064 2274 MERSFPETMGSlCLTPEQVLLQLKYRYDVEVDhS 2307 yellow perch
ABQ42581      300 MERSFPEQLGSlCLTPEQVLLQLKYRYDIEVDqS 333  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap