1LNS


Conserved Protein Domain Family
PepX_N

?
pfam09168: PepX_N 
X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal
Members of this family adopt a secondary structure consisting of a helical bundle of eight alpha helices and three beta strands, the last alpha helix connecting to the first strand of the catalytic domain. The first strand of the N-terminus also forms a small parallel beta sheet with strand 5' of catalytic domain. The domain mediates dimerization of the protein, with two proline residues present in the domain being critical for interaction.
Statistics
?
PSSM-Id: 401200
View PSSM: pfam09168
Aligned: 26 rows
Threshold Bit Score: 163.578
Threshold Setting Gi: 122276424
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LNS_A                1 M----RFNHFSIVDKNFDEQLAELDQLGF---RWSVFWDEKKILKDFLIQSPSDMTa----------LQATAELDVIEFL 63 
Q04E49                1 MknnfKYNAFT--DDSFFDPFDELKRINLfddSFFENSF-HDNLKIFFKRMFPNCHsfeakkeaekaILVNGKNDLSTYL 77  Oenococc...
OTooleUCC:LRC_01770   1 M----KINQFAHAPAAFETKLEELSKLRFikaDAQQEDL-NLLWKNLLLKCFPQAKclaqkheklasLAATKTESVPEFI 75  Lactobac...
Q1G9E8                1 M----KYNQYAYVETSPEKATEELLAINFlpeNYSSLSF-SELLAVLTGNVLAEATtrqakdaklaeFAVDDQTDLAAFL 75  Lactobac...
Q1WRZ1                1 M----KFNQFAHVKVPFEQKLAELNRIAFlhaGDEDLAS-NHIYRLFLERAFPNFKteaaknhalsnLAATENADILTYL 75  Lactobac...
WP_014082391          1 M----KINQFAQSHPDLSTIKKELQLVGFkteQTDA----KKLFYELLKQIQINPTsssnfqeklnqLLATNQERLGDFF 72  Lactobac...
WP_014215875          1 M----KNNQFGRLTISRSHELHELQSINFt--DGTLFENANTQFADFLIHATLSANsepvyqeklhnLLATPSKDLAEFF 74  Pediococ...
Q03H46                1 M----KNNQFGRIRLDRTTELEELKNIHFi--DADLLADPKAQLKDFLKRSCLVSNseatfqqklsnLLATPDQTMAAFF 74  Pediococ...
KRK50472              1 M----KINQFSITSTTPQARRQELMQIHLlrkNEEQTLTPNAMFETFLARIHMASAqpivtkqwlhdLLATPDLALDDWF 76  Lactobac...
Q03YV0                2 I------NQYGRIAVDSATELEELRAVGF----------NSEDFETLLRRALTNYKtyeaqndwlreHVATDEQNIFLFL 65  Leuconos...
1LNS_A               64 KSS-IELDWEIFWNIALQLLDFVPNFDFEIGKAFEYAKNSNLPQIEAE--MTTENIISAFYYLLCTRRKTGMILVEHWVS 140
Q04E49               78 ERDfQSISAEDFYLVIDQLLDFNLGLEIDFGSGKQFLIDSGQQVLSAVk-IDSTNLADFLFNALILRSANGLSLIDNLVS 156 Oenococc...
OTooleUCC:LRC_01770  76 EK--KTVNLTVFYAVAMQLLQFEPDTEFDIDNPLKSMDELGVFHADKl--EDSTDLISAFYDLLATHGKNGQTLLDHLGN 151 Lactobac...
Q1G9E8               76 LDTpTAITASQFANVALQLLGYHPNYDYSLTDPLTCGEKHALPAF-KDl-TSKEELIFAFYRLLNTRSKNGQILLDVMAG 153 Lactobac...
Q1WRZ1               76 NS--SKINARVFYAVGLQLLGFEAELDFDLKDPFSAMDKLNLPYQKEi--HHRDDVINAWYDLLCTSTKKGQNLLDILAN 151 Lactobac...
WP_014082391         73 STE-TPLSAEVFYLVALQLLGFQPTVDFKIDQPLESVIKLNLFHHETi--DTTNQLIEAWYDLLNTHGKNDLTLLDSIAA 149 Lactobac...
WP_014215875         75 AAD-LPLTVDVFYLVALQLLKFEAGTDFEVDNPIAAMDKINLPHVDSv--KDAKEVAHAWYLLLTTHTKNGETFLDYLTQ 151 Pediococ...
Q03H46               75 ESD-QPLTLEIFILLELQLLQFEADTDYQIEDPLSAISKIQLPELDLKnfETSADVAHAWYNLLTTHTKNGEVYLDRLTQ 153 Pediococ...
KRK50472             77 DQN-QILTDEVFYLVALQLLDFEAAVDFDITASLATVKKIGLPVESHQk-WTTANVIDAFYLLLNTHNKNGQSLIDHLTA 154 Lactobac...
Q03YV0               66 ETK-QPLTQAVFYCIAAQLLGFTEALAGNGYNGVATFRQLGLPIA------TVNNLRHAWYELLNSHTNNGLLFIDELAS 138 Leuconos...
1LNS_A              141 EGL 143
Q04E49              157 DGF 159 Oenococcus oeni PSU-1
OTooleUCC:LRC_01770 152 LGF 154 Lactobacillus ruminis ATCC 27782
Q1G9E8              154 KGY 156 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 = JCM 1002
Q1WRZ1              152 RGY 154 Lactobacillus salivarius UCC118
WP_014082391        150 KGY 152 Lactobacillus sanfranciscensis
WP_014215875        152 EGY 154 Pediococcus claussenii
Q03H46              154 QGY 156 Pediococcus pentosaceus ATCC 25745
KRK50472            155 EGF 157 Lactobacillus reuteri DSM 20016
Q03YV0              139 QGY 141 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap