1LMI


Conserved Protein Domain Family
DUF1942

?
pfam09167: DUF1942 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1942)
Members of this family of bacterial proteins assume a beta-sandwich structure consisting of two antiparallel beta-sheets similar to an immunoglobulin-like fold, with an additional small, antiparallel beta-sheet. The longer-stranded beta-sheet is made up of four antiparallel beta-strands. The shorter-stranded beta-sheet consists of five beta-strands, four of these beta-strands form an antiparallel beta-sheet. The exact function of this family of proteins is unknown, though a putative role includes involvement in host-bacterial interactions involved in endocytosis or phagocytosis, possibly during bacterial internalisation.
Statistics
?
PSSM-Id: 401199
View PSSM: pfam09167
Aligned: 21 rows
Threshold Bit Score: 139.401
Threshold Setting Gi: 81414190
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LMI_A              4 PITGKLGSELTMTDt-vGQVVLGWKVSDLKSSTAVIPgYPVAGQVWEATATVNAIRGSVTPAVSQFNARTADGINYRVLW 82  Mycobacter...
tigr:MSMEG_5617    30 eteAGFGEAQDLVAp-tGD-TASVTVTDIALSSDQIP-TEVEGQLYEATATIEAKEGTVTPVLSNFNARTADGQSYQAVY 106 Mycoliciba...
AEV71457           31 dSIKAFGVEQHINDvasGGPLIGYTVTGLQPSTDTIP-YPVAGRLYEATLKVNAFGNWANPVIPRFNARAENGQGYQAIT 109 Mycoliciba...
AEV72848           31 dNIKPFGNQVRMLDs-nGFPMIGYTVRDLSPSSDPVP---HNGQLYEATMTVDAFGGVANPEIQRFNARAENRAMYRLL- 105 Mycoliciba...
MSJTU:JDM601_0992  31 PTVVGFGETEEIQSp-gGAI--DYTVKNLQPSGH-------NDGIWYSDVTAKAVSGTPTPNIADFNARAVNSSTFAVMK 100 Mycoliciba...
OLT70659           32 PEDLDFGQKAEIPSp-gGAI--DYTVSTLEPSGH-------NDGVWYSDVTARAVSGSPTPNIADFNARAVNSSTYAVMK 101 Mycobacter...
Q73Z85             32 PQVLQFGQMAEISSn-gGTI--DYTVSNLQPSGH-------NDGVWYSDVTAKGVSGNAVPNIADFNARAVNSSTFAVMK 101 Mycobacter...
MSJTU:JDM601_3074  32 PAIQPFGTPEQLHD---GALSTSYTVSNLGPANVVIPgYQPDGKLYQADVTARADRGTVTPLVTAFNARAANSDTYRVIN 108 Mycoliciba...
VBC:MMAR_1823      26 PTIQGFGTSERLVD---GPMVTSYTVGNLQLSDVTIAgYLPQGQLYSADVTARSVTGTITPLVSSFNARAANGDTYGVVN 102 Mycobacter...
WP_023986187       37 VTTTHLGSQAQLHD---GNIVQGWTVTGLKVSTDVIP-AQIHGTLWEATATDEALQGNATPIVSNLNARARNGETYRALW 112 Mycobacter...
1LMI_A             83 QAAGPDTISGATIPQGEQSTGKIYFDV-TGPSPTIVAM-NNGMEDLL 127 Mycobacterium tuberculosis
tigr:MSMEG_5617   107 EVPASEG-NPEPLTEGASTTGKVYFDV-KGEAPDSVVY-SDVGSDEV 150 Mycolicibacterium smegmatis MC2 155
AEV71457          110 NVFIPQAIQGNAVPPNGSSSGKLYFDV-VGVDPNSVVY-NDGVRDIL 154 Mycolicibacterium rhodesiae NBB3
AEV72848          106 ---TAAGI-GGPVQPGGSATGKLYFEV-VGEAPNSVVY-NDGTRDVI 146 Mycolicibacterium rhodesiae NBB3
MSJTU:JDM601_0992 101 G-NEVDGLPNGPIAQGSQSSGRLYFDVkSGTAPDSVVYrDAGGHDKV 146 Mycolicibacter sinensis
OLT70659          102 G-DKPDGLPNQPLTAGSQTTGRIYFDVrGGTAPDSVVYrDAGGTDKV 147 Mycobacteroides abscessus subsp. abscessus
Q73Z85            102 G-NQTDGLPEGPLPLGTPVTGRLYFDVrNGTNPDSVVYrDAGGTDKV 147 Mycobacterium avium subsp. paratuberculosis
MSJTU:JDM601_3074 109 TVPTPGGINPGPIAQGASADGKIYFDV-TGPPPDGVVY-NDGVQDVM 153 Mycolicibacter sinensis
VBC:MMAR_1823     103 EVPAPGGLNPAPILQGNSQSGVLYFDV-TGPPPNGVVY-NDGVQDVL 147 Mycobacterium marinum M
WP_023986187      113 GVATAQGVNPSTLAQGQKTTGKVYFDV-TGEAPDSVVY-ATSAADLI 157 Mycobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap