4D6T


Conserved Protein Domain Family
Ubiq-Cytc-red_N

?
pfam09165: Ubiq-Cytc-red_N 
Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
Members of this family adopt a structure consisting of many antiparallel beta sheets, with few alpha helices, in a non-globular arrangement. They are required for proper functioning of the respiratory chain.
Statistics
?
PSSM-Id: 401197
View PSSM: pfam09165
Aligned: 22 rows
Threshold Bit Score: 63.5016
Threshold Setting Gi: 1005959847
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4D6T_E         3 SVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATsESPVLDLKRSVLCRESLRGQAAGRPL-VASVSLNVPASV 76 
NP_001165810   2 NVITKSSSIAPFAKAAINVISTGVKPVRSNSKISR-KKITLPSPIQRTLNYTLSQDLHLNGAiRVSSGIAVSSQI 75  jewel wasp
XP_012062278   2 NVIAKSTTLSPFLRATATVVSNGGMPVAATSKVNK-PKITVPEPFRRRLQQTIYQDLLTGPM-CISSGVAVSTQV 74  Atta cephalotes
EFN61684       2 NVIAKSTTVSPFLRATATVVSNGGVPVAATGKIQK-PKVTVPPTVKRTLGQSLYQDLLTGPT-CISSGITTSTQI 74  Florida carpenter ant
EFN79013       2 NVIAKSTTLSPFLRATATAVSNGGKPVAATGKVLK-PKVAVPPTVVRVHSQSFYQDLLSGPT-CISSGVAVSTQV 74  Jerdon's jumping ant
XP_015788261   3 SISTRSGNLSSLIKATAQAV--NAKPAGPAVVAGH-EHY-VPEDGKKWSVSSLSSQSILKKSsAVSLSVNGISQI 73  two-spotted spider mite
2_pfamImport   1 --VAKSGNLAPFLKGVSQTLGNNLKPSAPAVVHGT-DYFVTPNTPKVHVSHTLRKILPTNDI-KVRGGPGVTTQV 71 
OWR49045       3 SVA-RAGHLAPFFKASCSITNNGLKPVVAIAAP-A-EKLVVQPLPKTSTVQSLHGALPVQSL-KVRHGNFAPTQV 73  Danaus plexippus ple...
NP_001106738   3 SVV-RAGHLAPYFKSSTQVVANSLKPLVVVPTP-S-EKTVVLPLPKTSTVETLHGSLPIQGL-KVKAGTRVPAQV 73  domestic silkworm
XP_780127      3 SAVSKVGVVAPFVSATSQNVGSQLRQAVVAAPSIV-HKFTLPEREDRLTNVKLGALLPKSHGtRVTSGVQAAGHV 76  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap