1J78


Conserved Protein Domain Family
VitD-bind_III

?
pfam09164: VitD-bind_III 
Click on image for an interactive view with Cn3D
Vitamin D binding protein, domain III
Members of this family are predominantly found in Vitamin D binding protein, and adopt a multi-helical structure. They are required for formation of an actin 'clamp', allowing the protein to bind to actin.
Statistics
?
PSSM-Id: 401196
View PSSM: pfam09164
Aligned: 11 rows
Threshold Bit Score: 105.935
Threshold Setting Gi: 637308632
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J78_A       389 ELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEID 451 human
XP_007667375 418 ELCGDYSELTFTEYKKGLTEKFSQKQPDASPATIKELVERRATFASSCCISNAPPRYCSTQID 480 platypus
XP_008110383 408 QLCDDYTDHIFLEFKKRLRDTYVKKFPNATEAVLSALVQQRGRFASTCCFLNAPPSYCGMKVK 470 green anole
XP_005044653 406 QLCGLYHRLPFLDFKKRLREILAQAEPEAGPEHLEQLLEQRVSFASTCCLPDAPPLLCAAKVS 468 Collared flycatcher
NP_990213    407 QLCGQYTELNFLDFKKRLRDSIRQTRPDASPELLTQLTDQRADFASTCCPANSPPLYCVAQVT 469 chicken
XP_023361468 413 ELCGDFSQHTFTEYKKRLTEHFKTKFPETNSKIIKEMVENRTDFASKCCLMNSPPLYCNTQID 475 Tasmanian devil
XP_013005577 405 ELCADYSENTFTEYKKKLTERLRTKLPGATPTELAGQVERHSDFASKCCSINSPPRYCDAQId 467 domestic guinea pig
P04276       405 EMCADYSENTFTEYKKKLAERLRTKMPNASPEELADMVAKHSDFASKCCSINSPPRYCSSQID 467 Norway rat
XP_004766355 405 KLCADYSENTFTEYKKKLAEQLKAQLPDASALELQGLIDKRSDFASKCCSINSPPLYCDSEID 467 domestic ferret
NP_001015745 405 ELCGDYHKYPFLEFKERLNKALSRRVPKLSTSQVKEMVEARSSLASTCCLINAPPVYCREMIN 467 tropical clawed frog
XP_006010798 408 EVCLEYKKYDFTDYKKRVAEQFKEKLPTATPEELETRIEERTHFASTCCSQQAPTIYCGKMig 470 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap