3RW6


Conserved Protein Domain Family
Tap-RNA_bind

?
pfam09162: Tap-RNA_bind 
Tap, RNA-binding
Members of this family adopt a structure consisting of an alpha+beta sandwich with an antiparallel beta-sheet, arranged in a 2(beta-alpha-beta) motif. They are mainly found in mRNA export factors, and mediate the sequence nonspecific nuclear export of cellular mRNAs as well as the sequence-specific export of retroviral mRNAs bearing the constitutive transport element.
Statistics
?
PSSM-Id: 401194
View PSSM: pfam09162
Aligned: 59 rows
Threshold Bit Score: 85.6916
Threshold Setting Gi: 1253279991
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3RW6_A         21 SKNWFKITIPYGRKYDKAWLLSMIQSKCS-VPFTPIEFHYENTRAQFFVEDASTASALKAVNYKI-LDRENRRISIIINS 98  
EKC41871       83 SPQWYKVIIPYGKKGGKDFILKSLTERVN-IPFKPVDFHFEQEKAVFFVQEKQEANAIRSQDKKI-QLPNGFKMIVLVKP 160  Pacific oyster
PDM71324      701 EKAW-RVKIPSGQKYGAPFILSTLSAHVE--NLKPIMPKMFSTEFVFFVRDDDAAHAIRSVHRRIkHAETGDRLNIITNL 777  Pristionchus ...
EFX66242      111 GSSWSKVTIPHGKKFEKDFILKTLLNASK-VSFIPIYYHIEGNNAVFFIEDSTAAEALSTLNKQI-TLHDGFKLIILVKW 188  common water ...
Q17MK6        127 PTSWYEVKIPYGHKYEKEFILRSLVNAISpLIFIPQYWKVEDTAVSFYIEDFQAAEALQKIDRTI-GLPDGRKMIVIVRN 205  yellow fever ...
Q7QK79          7 P--WYEVRIPYGNKYEKEFILRSIQQAITpQMFIPLYYKANESGAVFFVEDFQAADAIMRANRSI-QTPDGRRMILVVRN 83   Anopheles gam...
ETN60147      137 QTSWYEVRIPYGQKYEKEFVLRSIQQAISpQIFIPRYYKAAESCATFYVEDFATAEAIQKMDRKI-DTPDGRKMILLVRS 215  Anopheles dar...
1_pfamImport    1 PSYWYKVTIRYGGRYEKDYLLKLLGNYIKpLPFIPIGYKVTSNDATFTIEDHNAAEELLNADKRI-TVNDGFKINLQVRS 79  
XP_012060862  128 ESSWYRVTIPYGQKYEKDFIINTLLNYITpDVFVPILYKTSTTDASFYIDDYKTAVALQSCDYKI-TMSDGFKLQVKVKP 206  Atta cephalotes
XP_397092     122 DSNWYKITIPYGHKYDKDYIINNLLSYIApETFIPFMYKVVGNEATFYVDDNKIAMALADSDRKI-TTTDGFKLQVRVSK 200  honey bee
3RW6_A         99 S-APPH 103 
EKC41871      161 S-PPPV 165  Pacific oyster
PDM71324      778 V-NAPW 782  Pristionchus pacificus
EFX66242      189 SpAPNL 194  common water flea
Q17MK6        206 S-NPQY 210  yellow fever mosquito
Q7QK79         84 N-PPPT 88   Anopheles gambiae str. PEST
ETN60147      216 N-HPVF 220  Anopheles darlingi
1_pfamImport   80 F-NPLV 84  
XP_012060862  207 G-FPVY 211  Atta cephalotes
XP_397092     201 AgFPQC 206  honey bee
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap